DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2ab3 and His2A:CG33829

DIOPT Version :10

Sequence 1:NP_001268460.1 Gene:H2ab3 / 624957 MGIID:3644875 Length:115 Species:Mus musculus
Sequence 2:NP_001027326.1 Gene:His2A:CG33829 / 3772447 FlyBaseID:FBgn0053829 Length:124 Species:Drosophila melanogaster


Alignment Length:91 Identity:36/91 - (39%)
Similarity:57/91 - (62%) Gaps:1/91 - (1%)


- Green bases have known domain annotations that are detailed below.


Mouse    19 RSRTSRAELIFAVSLVEQHLREVSRARRLSDTVPIFLAAILESLTRRLLELAGNEAQRRGTERRI 83
            :||::||.|.|.|..:.:.||:.:.|.|:....|::|||::|.|...:|||||| |.|...:.||
  Fly    15 KSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGN-AARDNKKTRI 78

Mouse    84 TPELLDLAVYSNMELSDVFQFITISQ 109
            .|..|.||:.::.||:.:...:||:|
  Fly    79 IPRHLQLAIRNDEELNKLLSGVTIAQ 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2ab3NP_001268460.1 H2A 25..112 CDD:197711 33/85 (39%)
His2A:CG33829NP_001027326.1 PTZ00017 16..124 CDD:185399 36/90 (40%)

Return to query results.
Submit another query.