DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLIP1 and TBCB

DIOPT Version :9

Sequence 1:NP_001376220.1 Gene:CLIP1 / 6249 HGNCID:10461 Length:2148 Species:Homo sapiens
Sequence 2:NP_611425.1 Gene:TBCB / 37244 FlyBaseID:FBgn0034451 Length:244 Species:Drosophila melanogaster


Alignment Length:109 Identity:40/109 - (36%)
Similarity:52/109 - (47%) Gaps:9/109 - (8%)


- Green bases have known domain annotations that are detailed below.


Human   185 ISNLTKTASESISNLSE-----AGSIKKGERELKIGDR--VLVGG--TKAGVVRFLGETDFAKGE 240
            |:.:.|...|.:....|     |..|:|......:|.|  |.|.|  |:.|.:|:.|..:...|.
  Fly   126 INRMGKYNDEEMQQAEEKKRLQAEEIQKRAELCVLGGRCEVTVPGNPTRRGTIRYNGPLEGKSGH 190

Human   241 WCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFP 284
            :.|||.|||||||:|:..|..||.|.|.||.|.....||...||
  Fly   191 FIGVEYDEPLGKNNGSFGGKAYFTCAPNYGGFVSPLSVTVGDFP 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLIP1NP_001376220.1 CAP_GLY 60..124 CDD:396049
CAP_GLY 214..278 CDD:396049 29/67 (43%)
SbcC <335..835 CDD:223496
Smc 612..1442 CDD:224117
Smc 1176..1977 CDD:224117
CLIP1_ZNF 2126..2142 CDD:406934
TBCBNP_611425.1 Alp11_N 12..95 CDD:176384
CAP_GLY 161..225 CDD:279625 29/63 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.