DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RRAS and Rala

DIOPT Version :9

Sequence 1:NP_006261.1 Gene:RRAS / 6237 HGNCID:10447 Length:218 Species:Homo sapiens
Sequence 2:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster


Alignment Length:190 Identity:90/190 - (47%)
Similarity:117/190 - (61%) Gaps:1/190 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    30 HKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICSVDGIPARLDILDTAGQEEFGAMR 94
            ||:::||.|||||||||:||:...||.||:||..|||.|...:||...::|||||||||::.|:|
  Fly    12 HKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIR 76

Human    95 EQYMRAGHGFLLVFAINDRQSFNEVGKLFTQILRVKDRDDFPVVLVGNKADLESQRQVPRSEASA 159
            :.|.|:|.|||.||:|.|.:||....:...||||||:.:..|.:|||||.||..:|:||.||...
  Fly    77 DNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVPLSECQL 141

Human   160 FGASHHVAYFEASAKLRLNVDEAFEQLVRAVR-KYQEQELPPSPPSAPRKKGGGCPCVLL 218
            ......|.|.|.|||.|.|||:.|..|:|.:| :..|.....|..:..|.|.....|.||
  Fly   142 RAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTEDSKATSGRAKDRCKKRRLKCTLL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RRASNP_006261.1 M_R_Ras_like 28..191 CDD:133345 82/160 (51%)
Effector region 58..66 4/7 (57%)
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 82/161 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1259506at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.