DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RRAD and rhb1

DIOPT Version :9

Sequence 1:NP_001122322.1 Gene:RRAD / 6236 HGNCID:10446 Length:308 Species:Homo sapiens
Sequence 2:NP_595194.1 Gene:rhb1 / 2540853 PomBaseID:SPBC428.16c Length:185 Species:Schizosaccharomyces pombe


Alignment Length:176 Identity:60/176 - (34%)
Similarity:94/176 - (53%) Gaps:18/176 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    93 KVLLLGAPGVGKSALARIFGGVEDG------PEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGG 151
            ::.:||:..||||:|...:  ||:.      |..|   :|:.::|...|:|.:..:.|...||..
pombe     8 RIAVLGSRSVGKSSLTVQY--VENHFVESYYPTIE---NTFSKNIKYKGQEFATEIIDTAGQDEY 67

Human   152 RWLPG-HCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSV 215
            ..|.. |.:.: ..||:|||:|.|.|||....:|.::.....|:.|||::|||||||...|.|:.
pombe    68 SILNSKHSIGI-HGYVLVYSITSKSSFEMVKIVRDKILNHTGTEWVPIVVVGNKSDLHMQRAVTA 131

Human   216 DEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRRDSKEAN 261
            :||:|.|..:.|.:.|.||..:.||...||.::.:|     .|:||
pombe   132 EEGKALANEWKCAWTEASARHNENVARAFELIISEI-----EKQAN 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RRADNP_001122322.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..88
RGK 92..308 CDD:206715 60/176 (34%)
RAS 92..252 CDD:214541 56/165 (34%)
Calmodulin-binding 278..297
rhb1NP_595194.1 small_GTPase 5..170 CDD:197466 57/172 (33%)
RheB 6..184 CDD:206709 60/176 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.