Sequence 1: | XP_024307727.1 | Gene: | RPS21 / 6227 | HGNCID: | 10409 | Length: | 359 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001005126.1 | Gene: | rps21 / 448708 | XenbaseID: | XB-GENE-1007930 | Length: | 83 | Species: | Xenopus tropicalis |
Alignment Length: | 62 | Identity: | 58/62 - (93%) |
---|---|---|---|
Similarity: | 61/62 - (98%) | Gaps: | 0/62 - (0%) |
- Green bases have known domain annotations that are detailed below.
Human 270 MQNDAGEFVDLYVPRKCSASNRIIGAKDHASIQMNVAEVDKVTGRFNGQFKTYAICGAIRRM 331 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RPS21 | XP_024307727.1 | Ribosomal_S21e | 270..>331 | CDD:307419 | 56/60 (93%) |
rps21 | NP_001005126.1 | Ribosomal_S21e | 1..80 | CDD:366538 | 58/62 (94%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 149 | 1.000 | Domainoid score | I21399 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 1 | 1.000 | - | - | H90915 | |
Inparanoid | 1 | 1.050 | 157 | 1.000 | Inparanoid score | I12568 |
NCBI | 1 | 1.000 | - | - | ||
OMA | 1 | 1.010 | - | - | QHG54242 | |
OrthoDB | 1 | 1.010 | - | - | D1571849at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0002785 | |
OrthoInspector | 1 | 1.000 | - | - | oto156946 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR10442 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1237 |
SonicParanoid | 1 | 1.000 | - | - | X1875 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
13 | 13.110 |