DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RPS21 and RpS21

DIOPT Version :9

Sequence 1:XP_024307727.1 Gene:RPS21 / 6227 HGNCID:10409 Length:359 Species:Homo sapiens
Sequence 2:NP_001259970.1 Gene:RpS21 / 33487 FlyBaseID:FBgn0015521 Length:83 Species:Drosophila melanogaster


Alignment Length:62 Identity:45/62 - (72%)
Similarity:51/62 - (82%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   270 MQNDAGEFVDLYVPRKCSASNRIIGAKDHASIQMNVAEVDKVTGRFNGQFKTYAICGAIRRM 331
            |:|||||.||||||||||||||||.||||||:|:::.:||..|||.....|||||||.||||
  Fly     1 MENDAGENVDLYVPRKCSASNRIIHAKDHASVQLSIVDVDPETGRQTDGSKTYAICGEIRRM 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RPS21XP_024307727.1 Ribosomal_S21e 270..>331 CDD:307419 43/60 (72%)
RpS21NP_001259970.1 Ribosomal_S21e 1..77 CDD:279574 45/62 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156765
Domainoid 1 1.000 119 1.000 Domainoid score I5831
eggNOG 1 0.900 - - E1_KOG3486
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H90915
Inparanoid 1 1.050 126 1.000 Inparanoid score I4706
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54242
OrthoDB 1 1.010 - - D1571849at2759
OrthoFinder 1 1.000 - - FOG0002785
OrthoInspector 1 1.000 - - oto89175
orthoMCL 1 0.900 - - OOG6_101819
Panther 1 1.100 - - LDO PTHR10442
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1237
SonicParanoid 1 1.000 - - X1875
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.