DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RPS16 and rps-16

DIOPT Version :9

Sequence 1:NP_001350789.1 Gene:RPS16 / 6217 HGNCID:10396 Length:152 Species:Homo sapiens
Sequence 2:NP_001379167.1 Gene:rps-16 / 179998 WormBaseID:WBGene00004485 Length:144 Species:Caenorhabditis elegans


Alignment Length:82 Identity:61/82 - (74%)
Similarity:69/82 - (84%) Gaps:0/82 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     7 LQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAGVDIRVR 71
            :||||.||||||||||||||:|.|||||||||||.:||:.|:.||.||:||:|||||..||||:|
 Worm     5 VQSVQTFGRKKTATAVAHCKKGQGLIKVNGRPLEFLEPQILRIKLQEPLLLVGKERFQDVDIRIR 69

Human    72 VKGGGHVAQIYGESQEL 88
            |.|||||||||...|.|
 Worm    70 VSGGGHVAQIYAVRQAL 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RPS16NP_001350789.1 Ribosomal_S9 6..>86 CDD:320913 59/78 (76%)
rps-16NP_001379167.1 PTZ00086 1..144 CDD:185437 61/82 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161454993
Domainoid 1 1.000 215 1.000 Domainoid score I1731
eggNOG 1 0.900 - - E1_COG0088
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H794
Inparanoid 1 1.050 225 1.000 Inparanoid score I2546
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62208
OrthoDB 1 1.010 - - D1347615at2759
OrthoFinder 1 1.000 - - FOG0002170
OrthoInspector 1 1.000 - - oto21389
orthoMCL 1 0.900 - - OOG6_100841
Panther 1 1.100 - - LDO PTHR21569
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1233
SonicParanoid 1 1.000 - - X1447
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.