DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RPS16 and Rps16

DIOPT Version :9

Sequence 1:NP_001350789.1 Gene:RPS16 / 6217 HGNCID:10396 Length:152 Species:Homo sapiens
Sequence 2:XP_006228674.1 Gene:Rps16 / 140655 RGDID:621031 Length:150 Species:Rattus norvegicus


Alignment Length:151 Identity:117/151 - (77%)
Similarity:124/151 - (82%) Gaps:2/151 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     1 MPSKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAG 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat     1 MPSKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAG 65

Human    66 VDIRVRVKGGGHVAQIYGESQELGAWRRWLWEGGLHSAPVPFNCVSFSQLSVSPSPKPWWPITRN 130
            |||||||||||||||||||.::||...|.|.:.|.....:..:||  .|||.|.|.|.||.||:|
  Rat    66 VDIRVRVKGGGHVAQIYGECEDLGVSVRQLLKQGWVFTKLFGHCV--LQLSGSLSQKLWWLITKN 128

Human   131 MWMRLPRRRSKTSSSSMTGPC 151
            |||:..|||||.||||..|||
  Rat   129 MWMKPLRRRSKISSSSTIGPC 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RPS16NP_001350789.1 Ribosomal_S9 6..>86 CDD:320913 79/79 (100%)
Rps16XP_006228674.1 Ribosomal_S9 6..>102 CDD:294239 84/95 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83685264
Domainoid 1 1.000 266 1.000 Domainoid score I17724
eggNOG 1 0.900 - - E1_COG0088
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H794
Inparanoid 1 1.050 291 1.000 Inparanoid score I14727
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG62208
OrthoDB 1 1.010 - - D1347615at2759
OrthoFinder 1 1.000 - - FOG0002170
OrthoInspector 1 1.000 - - oto143760
orthoMCL 1 0.900 - - OOG6_100841
Panther 1 1.100 - - LDO PTHR21569
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1447
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1717.310

Return to query results.
Submit another query.