DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RPS15A and RpS15Ab

DIOPT Version :9

Sequence 1:NP_001010.2 Gene:RPS15A / 6210 HGNCID:10389 Length:130 Species:Homo sapiens
Sequence 2:NP_610616.1 Gene:RpS15Ab / 36142 FlyBaseID:FBgn0033555 Length:130 Species:Drosophila melanogaster


Alignment Length:130 Identity:114/130 - (87%)
Similarity:123/130 - (94%) Gaps:0/130 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MVRMNVLADALKSINNAEKRGKRQVLIRPCSKVIVRFLTVMMKHGYIGEFEIIDDHRAGKIVVNL 65
            ||||||||||||.|||||||||||||:|||||||::||||||||||||||||::|||||||||||
  Fly     1 MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGKIVVNL 65

Human    66 TGRLNKCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKHTGGKILGFFF 130
            |||||||||||||||..:.|:|||.||||||||||::|||||.||||||||||||.|||||||||
  Fly    66 TGRLNKCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARRKHLGGKILGFFF 130

Human   131  130
              Fly   131  130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RPS15ANP_001010.2 PTZ00158 1..130 CDD:185487 112/128 (88%)
RpS15AbNP_610616.1 PTZ00158 1..130 CDD:185487 112/128 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155552
Domainoid 1 1.000 232 1.000 Domainoid score I2424
eggNOG 1 0.900 - - E1_COG0096
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128982
Inparanoid 1 1.050 244 1.000 Inparanoid score I3306
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62199
OrthoDB 1 1.010 - - D1417658at2759
OrthoFinder 1 1.000 - - FOG0001025
OrthoInspector 1 1.000 - - otm41638
orthoMCL 1 0.900 - - OOG6_100322
Panther 1 1.100 - - O PTHR11758
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2269
SonicParanoid 1 1.000 - - X687
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.