DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RPS13 and rps13

DIOPT Version :9

Sequence 1:NP_001008.1 Gene:RPS13 / 6207 HGNCID:10386 Length:151 Species:Homo sapiens
Sequence 2:NP_593900.1 Gene:rps13 / 2542108 PomBaseID:SPAC6F6.07c Length:151 Species:Schizosaccharomyces pombe


Alignment Length:151 Identity:113/151 - (74%)
Similarity:130/151 - (86%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MGRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQIGVILRDSHGVAQVRF 65
            |||||:.|||::.|||||.||.|.|.|..:|.|.|||.|.:|||::||||||.||||||:.||||
pombe     1 MGRMHSKGKGIASSALPYVRSPPAWCKADADSVVEQILKFSKKGMSPSQIGVTLRDSHGIPQVRF 65

Human    66 VTGNKILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIESRIHRLARYYK 130
            :||.||:||||:.||||:||||||:||||||:|||||||||||||:||||||||||||||||||:
pombe    66 ITGQKIMRILKANGLAPELPEDLYNLIKKAVSVRKHLERNRKDKDSKFRLILIESRIHRLARYYR 130

Human   131 TKRVLPPNWKYESSTASALVA 151
            ....|||.|||||:|||||||
pombe   131 KVGALPPTWKYESATASALVA 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RPS13NP_001008.1 PTZ00072 4..151 CDD:185427 108/146 (74%)
rps13NP_593900.1 PTZ00072 4..151 CDD:185427 108/146 (74%)
Ribosomal_S13_N 4..60 CDD:285331 35/55 (64%)
RpsO 44..147 CDD:223262 81/102 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1606
eggNOG 1 0.900 - - E1_COG0184
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128182
Inparanoid 1 1.050 234 1.000 Inparanoid score I983
OMA 1 1.010 - - QHG62177
OrthoFinder 1 1.000 - - FOG0003596
OrthoInspector 1 1.000 - - oto146853
orthoMCL 1 0.900 - - OOG6_100971
Panther 1 1.100 - - LDO PTHR11885
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1231
SonicParanoid 1 1.000 - - X2468
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.