DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RPS12 and NHP2

DIOPT Version :10

Sequence 1:NP_001007.2 Gene:RPS12 / 6206 HGNCID:10385 Length:132 Species:Homo sapiens
Sequence 2:NP_651965.1 Gene:NHP2 / 44005 FlyBaseID:FBgn0029148 Length:160 Species:Drosophila melanogaster


Alignment Length:153 Identity:28/153 - (18%)
Similarity:54/153 - (35%) Gaps:44/153 - (28%)


- Green bases have known domain annotations that are detailed below.


Human     2 AEEGIAAGGVMDVNTALQE---------------------------VLKTALIHDGLAR-GIREA 38
            |:|.:.|.|  ||....:|                           ::|.|:.|....| |:::.
  Fly    12 ADESVVASG--DVTIKEEESYDDKLIFVNAIAKPMAGKKLAKKCYKLVKKAMKHKTFLRNGLKDV 74

Human    39 AKALDKRQAHLCVLASNCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKV 103
            ...|.|.:..:|:.|.:......:..:.|:|.|..|..........||..:|:.:          
  Fly    75 QTRLRKGETGICIFAGDVTPVDIMCHLPAVCEEKGIPYTYTPSRADLGAAMGVKR---------- 129

Human   104 VGCSCVVVKDYGKESQAKDVIEE 126
             |...::|:   :..:.||:.:|
  Fly   130 -GTVALLVR---QNEEYKDLYDE 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RPS12NP_001007.2 Ribosomal_L7Ae 16..111 CDD:426153 18/122 (15%)
NHP2NP_651965.1 Ribosomal_L7Ae 51..146 CDD:426153 20/108 (19%)

Return to query results.
Submit another query.