DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RPS6 and RpS6

DIOPT Version :9

Sequence 1:NP_001001.2 Gene:RPS6 / 6194 HGNCID:10429 Length:249 Species:Homo sapiens
Sequence 2:NP_511073.1 Gene:RpS6 / 31700 FlyBaseID:FBgn0261592 Length:248 Species:Drosophila melanogaster


Alignment Length:250 Identity:187/250 - (74%)
Similarity:214/250 - (85%) Gaps:3/250 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     1 MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQGFPMKQ 65
            ||||:|:||||||||.||.||.|||.||||||...|.||.||:|||||.:||:||||||||||||
  Fly     1 MKLNVSYPATGCQKLFEVVDEHKLRVFYEKRMGQVVEADILGDEWKGYQLRIAGGNDKQGFPMKQ 65

Human    66 GVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVP 130
            ||||||||||||.|||||||||||||||||||||||||||:|||.||::||||||||||||||:|
  Fly    66 GVLTHGRVRLLLKKGHSCYRPRRTGERKRKSVRGCIVDANMSVLALVVLKKGEKDIPGLTDTTIP 130

Human   131 RRLGPKRASRIRKLFNLSKEDDVRQYVVRKPL-NKEGKKPRTKAPKIQRLVTPRVLQHKRRRIAL 194
            |||||||||:||||:|||||||||::|||:|| .|:.||..:||||||||:||.|||.|.|||||
  Fly   131 RRLGPKRASKIRKLYNLSKEDDVRRFVVRRPLPAKDNKKATSKAPKIQRLITPVVLQRKHRRIAL 195

Human   195 KKQRTKKNKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESSQK 249
            ||:|...:||.:|:|||||.:|.||:|.||:|  |||||.:|:|.|.|...|.:|
  Fly   196 KKKRQIASKEASADYAKLLVQRKKESKAKREE--AKRRRSASIRESKSSVSSDKK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RPS6NP_001001.2 Ribosomal_S6e 1..215 CDD:412654 169/214 (79%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 217..249 16/31 (52%)
RpS6NP_511073.1 Ribosomal_S6e 1..222 CDD:294602 172/220 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142963
Domainoid 1 1.000 222 1.000 Domainoid score I2591
eggNOG 1 0.900 - - E1_COG2125
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H85949
Inparanoid 1 1.050 368 1.000 Inparanoid score I2149
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53585
OrthoDB 1 1.010 - - D1326714at2759
OrthoFinder 1 1.000 - - FOG0003187
OrthoInspector 1 1.000 - - oto89004
orthoMCL 1 0.900 - - OOG6_100737
Panther 1 1.100 - - LDO PTHR11502
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1248
SonicParanoid 1 1.000 - - X2145
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.