DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment acbd7 and anox

DIOPT Version :10

Sequence 1:NP_001122240.1 Gene:acbd7 / 619256 ZFINID:ZDB-GENE-050913-108 Length:88 Species:Danio rerio
Sequence 2:NP_001027085.1 Gene:anox / 3771728 FlyBaseID:FBgn0064116 Length:243 Species:Drosophila melanogaster


Alignment Length:75 Identity:27/75 - (36%)
Similarity:36/75 - (48%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


Zfish     2 TLKAEFDQYAEDVKKVKTRPTDQELLDLYGLYKQAVVGDINIDKPGMIDLKGKAKWDAWDSRKGM 66
            |:...|....|.|.|........:||..||.||||..|......||::.|:.|:||.||.:...|
  Fly     8 TVDELFHLATEHVAKQSNSIGSADLLIFYGYYKQATNGPCKEQSPGLLQLQAKSKWQAWRNLGTM 72

Zfish    67 STEDAMKAYI 76
            |...|.:||:
  Fly    73 SQSAARQAYV 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acbd7NP_001122240.1 ACBP 3..87 CDD:469667 26/74 (35%)
anoxNP_001027085.1 ACBP 10..85 CDD:459982 26/73 (36%)
ANKYR <121..>231 CDD:440430
ANK repeat 148..179 CDD:293786
ANK repeat 181..212 CDD:293786
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.