DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MRPS12 and mrps12

DIOPT Version :10

Sequence 1:NP_066930.1 Gene:MRPS12 / 6183 HGNCID:10380 Length:138 Species:Homo sapiens
Sequence 2:XP_017951776.2 Gene:mrps12 / 733781 XenbaseID:XB-GENE-969291 Length:211 Species:Xenopus tropicalis


Alignment Length:110 Identity:89/110 - (80%)
Similarity:93/110 - (84%) Gaps:0/110 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    29 SMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVC 93
            ||||||||||.|.||..|.|||||.|.||||||||.|..|||||||||||||.|||||.|:|.:|
 Frog   101 SMATLNQMHRAGKPKPDPPKLGPTFGCPQLKGVVLKTMIRKPKKPNSANRKCARVRLSNGKEVIC 165

Human    94 FIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK 138
            |||||||.||||.|||||||||||||||||.:|||||||.||:||
 Frog   166 FIPGEGHNLQEHNIVLVEGGRTQDLPGVKLKIVRGKYDCAHVKKK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MRPS12NP_066930.1 Ribosomal_S12 32..138 CDD:239466 84/105 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..56 13/19 (68%)
mrps12XP_017951776.2 Ribosomal_S12 104..210 CDD:239466 84/105 (80%)

Return to query results.
Submit another query.