DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MRPS12 and RpS23

DIOPT Version :10

Sequence 1:NP_066930.1 Gene:MRPS12 / 6183 HGNCID:10380 Length:138 Species:Homo sapiens
Sequence 2:NP_610939.2 Gene:RpS23 / 36576 FlyBaseID:FBgn0033912 Length:143 Species:Drosophila melanogaster


Alignment Length:88 Identity:35/88 - (39%)
Similarity:50/88 - (56%) Gaps:8/88 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    48 KLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKCCRVRL-STGREAVCFIPGEG--HTLQEHQIVL 109
            |..|..|....||:||.....:.|:||||.|||.||:| ..|::...|:|.:|  :.::|:..||
  Fly    37 KANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGSLNYIEENDEVL 101

Human   110 VEG-GR----TQDLPGVKLTVVR 127
            |.| ||    ..|:|||:..||:
  Fly   102 VAGFGRKGHAVGDIPGVRFKVVK 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MRPS12NP_066930.1 Ribosomal_S12 32..138 CDD:239466 35/88 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..56 3/7 (43%)
RpS23NP_610939.2 PTZ00067 1..143 CDD:185422 35/88 (40%)

Return to query results.
Submit another query.