DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MRPS12 and tko

DIOPT Version :10

Sequence 1:NP_066930.1 Gene:MRPS12 / 6183 HGNCID:10380 Length:138 Species:Homo sapiens
Sequence 2:NP_001245490.1 Gene:tko / 31228 FlyBaseID:FBgn0003714 Length:154 Species:Drosophila melanogaster


Alignment Length:141 Identity:79/141 - (56%)
Similarity:90/141 - (63%) Gaps:17/141 - (12%)


- Green bases have known domain annotations that are detailed below.


Human     7 LHGLNTSLTCGPALVPRLWATCS-------MATLNQMHRLGP--PKRPPRKLGPTEGRPQLKGVV 62
            |..::.|.|..||:      .||       ||:|.||||.||  ..||||:  |.:|:|..||||
  Fly    20 LSDISNSFTSLPAI------QCSYETAVRGMASLQQMHRSGPHIKTRPPRQ--PLDGKPFAKGVV 76

Human    63 LCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVR 127
            |.|..:||||||||||||..||||||:|.|.:|||.||.||||.|||...||.||:|||||..||
  Fly    77 LKTLIKKPKKPNSANRKCVLVRLSTGKEMVAYIPGIGHNLQEHNIVLCRVGRLQDVPGVKLKAVR 141

Human   128 GKYDCGHVQKK 138
            |.||..||.||
  Fly   142 GVYDLAHVVKK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MRPS12NP_066930.1 Ribosomal_S12 32..138 CDD:239466 68/107 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..56 11/21 (52%)
tkoNP_001245490.1 Ribosomal_S12 46..152 CDD:239466 68/107 (64%)

Return to query results.
Submit another query.