DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MRPS12 and Mrps12

DIOPT Version :10

Sequence 1:NP_066930.1 Gene:MRPS12 / 6183 HGNCID:10380 Length:138 Species:Homo sapiens
Sequence 2:NP_001099709.1 Gene:Mrps12 / 292758 RGDID:1306221 Length:139 Species:Rattus norvegicus


Alignment Length:138 Identity:120/138 - (86%)
Similarity:126/138 - (91%) Gaps:0/138 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCT 65
            |||.||||||.|||:.|.||.|:||||.||||||||||||.||.||::|||||||||||||||.|
  Rat     1 MSWPGLLHGLTTSLSRGLALAPQLWATRSMATLNQMHRLGRPKEPPKRLGPTEGRPQLKGVVLRT 65

Human    66 FTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKY 130
            |.|||||||||||||||||||||:||||||||||||||||.:||||||||||||||||.||||||
  Rat    66 FIRKPKKPNSANRKCCRVRLSTGKEAVCFIPGEGHTLQEHHVVLVEGGRTQDLPGVKLKVVRGKY 130

Human   131 DCGHVQKK 138
            ||||||||
  Rat   131 DCGHVQKK 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MRPS12NP_066930.1 Ribosomal_S12 32..138 CDD:239466 95/105 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..56 15/19 (79%)
Mrps12NP_001099709.1 Ribosomal_S12 32..138 CDD:239466 95/105 (90%)

Return to query results.
Submit another query.