DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BCS1L and smid

DIOPT Version :9

Sequence 1:NP_001073335.1 Gene:BCS1L / 617 HGNCID:1020 Length:419 Species:Homo sapiens
Sequence 2:NP_523959.2 Gene:smid / 38824 FlyBaseID:FBgn0016983 Length:944 Species:Drosophila melanogaster


Alignment Length:166 Identity:48/166 - (28%)
Similarity:86/166 - (51%) Gaps:19/166 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   196 GLADRIVRDVQEF---IDNPKWYTDRGIPYRRGYLLYGPPGCGKSSFITALAGELEHSICLLSLT 257
            |..|..::::.|.   |.:|::|...|:...||.||:|||||||:....|::|:|:..:..:..|
  Fly   254 GGMDSTLKELCEMLIHIKSPEFYFQLGLLPSRGLLLHGPPGCGKTFLARAISGQLKMPLMEIPAT 318

Human   258 D-----SSLSDDRLNHLLSVAPQQS--LVLLEDVDAAFLSRDLAVENPVKYQGLGRLTFSGLLNA 315
            :     |..|::|:..:...|...|  ::.::::||...:|..|.::      :.|...|.|:::
  Fly   319 ELIGGISGESEERIREVFDQAIGYSPCVLFIDEIDAIGGNRQWASKD------MERRIVSQLISS 377

Human   316 LDGVASTE---ARIVFMTTNHVDRLDPALIRPGRVD 348
            ||.:.:.|   :.:|...|...|.|||.|.|.||.|
  Fly   378 LDNLKANEFGQSVVVIAATTRPDVLDPGLRRIGRFD 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BCS1LNP_001073335.1 BCS1_N 24..191 CDD:214980
RecA-like_BCS1 201..353 CDD:410918 46/161 (29%)
smidNP_523959.2 Nucleolin_bd 2..71 CDD:293330
SpoVK 271..919 CDD:223540 44/149 (30%)
AAA 287..418 CDD:278434 39/133 (29%)
P-loop_NTPase 679..>716 CDD:304359
AAA 699..830 CDD:278434
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.