DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BCS1L and Rpt6

DIOPT Version :9

Sequence 1:NP_001073335.1 Gene:BCS1L / 617 HGNCID:1020 Length:419 Species:Homo sapiens
Sequence 2:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster


Alignment Length:356 Identity:82/356 - (23%)
Similarity:142/356 - (39%) Gaps:121/356 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    72 TRTQHLSVETSYLQHESGRISTKFEFVPSPGNHFIWYRGKWIR---VERSREMQMIDLQTGTPWE 133
            |.|..:.:|::|                        ::|:..|   :::..|:|::..:......
  Fly     2 TVTNRMEIESAY------------------------HKGEGFRSYYIQKIEELQLVVAEKHQNLR 42

Human   134 SVTFTALGTDRKVFFNILEEARELALQQEEGKTVMYTAVGSEWRPFG------------------ 180
            .:.......:.||  .:|.|  ||.|.||:|     :.||...:|..                  
  Fly    43 RLQAQRNELNAKV--RMLRE--ELQLLQEQG-----SYVGEVVKPMDKKKVLVKVHPEGKFVVDL 98

Human   181 ---------------------------YPRRRRPLNSVVLQQ----------GLADRIVRDVQEF 208
                                       .|.:..||.|:::.:          |..|:.:::::|.
  Fly    99 DKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEV 163

Human   209 ID----NPKWYTDRGIPYRRGYLLYGPPGCGKSSFITALAGELEHSIC-LLSLTDSSL------S 262
            |:    :|:.:...||...:|.|||||||.||:....|:|   .|:.| .:.::.|.|      .
  Fly   164 IELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVA---HHTECTFIRVSGSELVQKFIGE 225

Human   263 DDRLNHLLSVAPQQ---SLVLLEDVDAAFLSRDLAVENPVKYQGLG-----RLTFSGLLNALDGV 319
            ..|:...|.|..::   |::.::::|:...||   :|:     |.|     :.|...|||.|||.
  Fly   226 GSRMVRELFVMAREHAPSIIFMDEIDSIGSSR---IES-----GSGGDSEVQRTMLELLNQLDGF 282

Human   320 ASTEARIVFMTTNHVDRLDPALIRPGRVDLK 350
            .:|:...|.|.||.:|.|||||:||||:|.|
  Fly   283 EATKNIKVIMATNRIDILDPALLRPGRIDRK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BCS1LNP_001073335.1 BCS1_N 24..191 CDD:214980 24/166 (14%)
RecA-like_BCS1 201..353 CDD:410918 55/169 (33%)
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 77/317 (24%)
SlyX <27..>69 CDD:294687 11/45 (24%)
AAA_16 152..>205 CDD:289934 18/55 (33%)
AAA 185..317 CDD:278434 49/140 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.