DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BCS1L and Rpt4

DIOPT Version :9

Sequence 1:NP_001073335.1 Gene:BCS1L / 617 HGNCID:1020 Length:419 Species:Homo sapiens
Sequence 2:NP_572308.3 Gene:Rpt4 / 31567 FlyBaseID:FBgn0028685 Length:397 Species:Drosophila melanogaster


Alignment Length:254 Identity:68/254 - (26%)
Similarity:113/254 - (44%) Gaps:62/254 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   119 REMQMIDLQTGT--PWESVTFTALG-TDRKV---FFNILEEARELALQQEEGKTVMYTAVGSEWR 177
            |::....|::||  ..:..|.|.:. ..|:|   .:|         :..|:...|.|:|:|    
  Fly    93 RQLDKAKLKSGTRVALDMTTLTIMRYLPREVDPLVYN---------MSHEDPGDVTYSAIG---- 144

Human   178 PFGYPRRRRPLNSVVLQQGLADRIVRDVQEFID----NPKWYTDRGIPYRRGYLLYGPPGCGKSS 238
                              ||.|:| |:::|.|:    ||:.:...||...:|.|||||||.||:.
  Fly   145 ------------------GLTDQI-RELREVIELPLLNPELFLRVGITPPKGCLLYGPPGTGKTL 190

Human   239 FITALAGELEHSICLLSLTDSSLSDD-------RLNHLLSVA--PQQSLVLLEDVDA---AFLSR 291
            ...|:|.:|:.:  .|.:..|::.|.       .:..:.:.|  .|..::.::::||   ...|.
  Fly   191 LARAVASQLDAN--FLKVVSSAIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSE 253

Human   292 DLAVENPVKYQGLGRLTFSGLLNALDGVASTEARIVFMTTNHVDRLDPALIRPGRVDLK 350
            ..:.:..:      :.|...|||.:||..|.....:.|.||..|.|||||:||||:|.|
  Fly   254 GTSADREI------QRTLMELLNQMDGFDSLGQVKMIMATNRPDTLDPALLRPGRLDRK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BCS1LNP_001073335.1 BCS1_N 24..191 CDD:214980 14/77 (18%)
RecA-like_BCS1 201..353 CDD:410918 51/166 (31%)
Rpt4NP_572308.3 RPT1 13..395 CDD:224143 68/254 (27%)
AAA 179..311 CDD:278434 42/136 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.