DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BCS1L and Spg7

DIOPT Version :9

Sequence 1:NP_001073335.1 Gene:BCS1L / 617 HGNCID:1020 Length:419 Species:Homo sapiens
Sequence 2:NP_570017.1 Gene:Spg7 / 31253 FlyBaseID:FBgn0024992 Length:819 Species:Drosophila melanogaster


Alignment Length:207 Identity:57/207 - (27%)
Similarity:98/207 - (47%) Gaps:15/207 - (7%)


- Green bases have known domain annotations that are detailed below.


Human   203 RDVQEFID---NPKWYTDRGIPYRRGYLLYGPPGCGKSSFITALAGELEHSICLLSLTDS----- 259
            ::|:||:|   :|:.|...|....||.||.|||||||:....|:|.|.:  :..||:..|     
  Fly   351 QEVKEFVDYLKSPEKYQRLGAKVPRGALLLGPPGCGKTLLAKAVATEAQ--VPFLSMNGSEFIEM 413

Human   260 --SLSDDRLNHLLSVAPQQS--LVLLEDVDAAFLSRDLAVENPVKYQGLGRLTFSGLLNALDGVA 320
              .|...|:..|.....:::  ::.::::||....|...........|....|.:.||..:||:|
  Fly   414 IGGLGAARVRDLFKEGKKRAPCIIYIDEIDAIGRQRSGTESMGQGSSGESEQTLNQLLVEMDGMA 478

Human   321 STEARIVFMTTNHVDRLDPALIRPGRVDLKEYVGYCSHWQLTQMFQRFYPG-QAPSLAENFAEHV 384
            :.|..::..:||..|.||.||:||||.|....:...:..:..::|::.... :..|....|::.:
  Fly   479 TKEGVLMLASTNRADILDKALLRPGRFDRHILIDLPTLAERKEIFEKHLSSVKLESPPTTFSQRL 543

Human   385 LRATNQISPAQV 396
            .|.|...|.|.:
  Fly   544 ARLTPGFSGADI 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BCS1LNP_001073335.1 BCS1_N 24..191 CDD:214980
RecA-like_BCS1 201..353 CDD:410918 50/161 (31%)
Spg7NP_570017.1 FtsH_ext 171..276 CDD:284011
FtsH_fam 333..787 CDD:273520 57/207 (28%)
AAA 378..513 CDD:278434 41/136 (30%)
Peptidase_M41 595..785 CDD:279742
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0465
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.