Sequence 1: | NP_001073335.1 | Gene: | BCS1L / 617 | HGNCID: | 1020 | Length: | 419 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_570017.1 | Gene: | Spg7 / 31253 | FlyBaseID: | FBgn0024992 | Length: | 819 | Species: | Drosophila melanogaster |
Alignment Length: | 207 | Identity: | 57/207 - (27%) |
---|---|---|---|
Similarity: | 98/207 - (47%) | Gaps: | 15/207 - (7%) |
- Green bases have known domain annotations that are detailed below.
Human 203 RDVQEFID---NPKWYTDRGIPYRRGYLLYGPPGCGKSSFITALAGELEHSICLLSLTDS----- 259
Human 260 --SLSDDRLNHLLSVAPQQS--LVLLEDVDAAFLSRDLAVENPVKYQGLGRLTFSGLLNALDGVA 320
Human 321 STEARIVFMTTNHVDRLDPALIRPGRVDLKEYVGYCSHWQLTQMFQRFYPG-QAPSLAENFAEHV 384
Human 385 LRATNQISPAQV 396 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
BCS1L | NP_001073335.1 | BCS1_N | 24..191 | CDD:214980 | |
RecA-like_BCS1 | 201..353 | CDD:410918 | 50/161 (31%) | ||
Spg7 | NP_570017.1 | FtsH_ext | 171..276 | CDD:284011 | |
FtsH_fam | 333..787 | CDD:273520 | 57/207 (28%) | ||
AAA | 378..513 | CDD:278434 | 41/136 (30%) | ||
Peptidase_M41 | 595..785 | CDD:279742 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0465 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |