DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RPL37 and RpL37a

DIOPT Version :9

Sequence 1:NP_000988.1 Gene:RPL37 / 6167 HGNCID:10347 Length:97 Species:Homo sapiens
Sequence 2:NP_001259561.1 Gene:RpL37a / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster


Alignment Length:92 Identity:69/92 - (75%)
Similarity:78/92 - (84%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MTKGTSSFGKRRNKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMR 65
            |||||||||||.|||||||||||..:||:|||||.:|||||.:.|.||||.|||||.|||||||:
  Fly     1 MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWSVKAKRRKTTGTGRMQ 65

Human    66 HLKIVYRRFRHGFREGTTPKPKRAAVA 92
            |||:|.||||:||||||..|||:|..:
  Fly    66 HLKVVRRRFRNGFREGTQAKPKKAVAS 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RPL37NP_000988.1 PTZ00073 1..88 CDD:240257 67/86 (78%)
RpL37aNP_001259561.1 PTZ00073 1..91 CDD:240257 69/89 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7200
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68110
Inparanoid 1 1.050 156 1.000 Inparanoid score I4300
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53564
OrthoDB 1 1.010 - - D1560654at2759
OrthoFinder 1 1.000 - - FOG0001246
OrthoInspector 1 1.000 - - oto88848
orthoMCL 1 0.900 - - OOG6_100852
Panther 1 1.100 - - LDO PTHR10768
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1133
SonicParanoid 1 1.000 - - X874
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.