DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RPL32 and RpL32

DIOPT Version :9

Sequence 1:NP_000985.1 Gene:RPL32 / 6161 HGNCID:10336 Length:135 Species:Homo sapiens
Sequence 2:NP_733339.1 Gene:RpL32 / 43573 FlyBaseID:FBgn0002626 Length:147 Species:Drosophila melanogaster


Alignment Length:132 Identity:102/132 - (77%)
Similarity:116/132 - (87%) Gaps:0/132 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     4 LRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKH 68
            :||..:|||||||||.|||||||||.|:...||||:|||||||||||||.|||||||||||:|:|
  Fly    16 IRPAYRPKIVKKRTKHFIRHQSDRYAKLSHKWRKPKGIDNRVRRRFKGQYLMPNIGYGSNKRTRH 80

Human    69 MLPSGFRKFLVHNVKELEVLLMCNKSYCAEIAHNVSSKNRKAIVERAAQLAIRVTNPNARLRSEE 133
            |||:||:|||||||:|||||||.|:.||.||||.||||.||.|||||.||::|:||||.||||:|
  Fly    81 MLPTGFKKFLVHNVRELEVLLMQNRVYCGEIAHGVSSKKRKEIVERAKQLSVRLTNPNGRLRSQE 145

Human   134 NE 135
            ||
  Fly   146 NE 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RPL32NP_000985.1 Ribosomal_L32e 17..124 CDD:396294 82/106 (77%)
RpL32NP_733339.1 PTZ00159 15..147 CDD:240297 100/130 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 181 1.000 Domainoid score I3493
eggNOG 1 0.900 - - E1_COG1717
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38347
Inparanoid 1 1.050 219 1.000 Inparanoid score I3582
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62201
OrthoDB 1 1.010 - - D1460684at2759
OrthoFinder 1 1.000 - - FOG0002079
OrthoInspector 1 1.000 - - oto89729
orthoMCL 1 0.900 - - OOG6_100702
Panther 1 1.100 - - LDO PTHR23413
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1129
SonicParanoid 1 1.000 - - X1375
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.