DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RPL28 and RpL28

DIOPT Version :9

Sequence 1:NP_001350626.1 Gene:RPL28 / 6158 HGNCID:10330 Length:170 Species:Homo sapiens
Sequence 2:NP_001163336.1 Gene:RpL28 / 38397 FlyBaseID:FBgn0035422 Length:144 Species:Drosophila melanogaster


Alignment Length:129 Identity:52/129 - (40%)
Similarity:83/129 - (64%) Gaps:5/129 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     2 SAHLQWMVVRNCSSFLIKRN--KQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVVI 64
            |:||.|:::||.::||:|:.  |:.:|||||||.:.:|:||:|::|:||:||.||||.||...|:
  Fly     4 SSHLNWLIIRNNNAFLLKKRDVKKPFSTEPNNLASVSSYRYSGIVHKKTLGVVPAADKKGFTAVL 68

Human    65 KRRSGQRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMLAGRVGRQQAVSSLEHQPRP 128
            |:....::||.:.||.......|.:|..:::::..:|||.||...|.|  |..||.. ..:|.|
  Fly    69 KKGKYAQRPAKNTVRVDFKAGPRRSLKKLKNLLIGSKYRKDLTQAALR--RASAVLR-SQKPAP 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RPL28NP_001350626.1 Ribosomal_L28e 5..110 CDD:307750 43/106 (41%)
RpL28NP_001163336.1 Ribosomal_L28e 7..123 CDD:396372 48/117 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146388
Domainoid 1 1.000 114 1.000 Domainoid score I6120
eggNOG 1 0.900 - - E1_KOG3412
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H768
Inparanoid 1 1.050 129 1.000 Inparanoid score I4661
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55213
OrthoDB 1 1.010 - - D1593474at2759
OrthoFinder 1 1.000 - - FOG0002533
OrthoInspector 1 1.000 - - oto88672
orthoMCL 1 0.900 - - OOG6_102892
Panther 1 1.100 - - LDO PTHR10544
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1124
SonicParanoid 1 1.000 - - X3821
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.