DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RPL27A and Y37E3.8

DIOPT Version :9

Sequence 1:NP_000981.1 Gene:RPL27A / 6157 HGNCID:10329 Length:148 Species:Homo sapiens
Sequence 2:NP_490927.1 Gene:Y37E3.8 / 171767 WormBaseID:WBGene00021350 Length:145 Species:Caenorhabditis elegans


Alignment Length:148 Identity:103/148 - (69%)
Similarity:121/148 - (81%) Gaps:3/148 - (2%)


- Green bases have known domain annotations that are detailed below.


Human     1 MPSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGLHHHRINFDKYHPGYFGKVGMKHYHLKR 65
            |...|||||||||||||||||||||||||||||||||.||||||.|||||||||||||:.:||.:
 Worm     1 MAHALRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGQHHHRINRDKYHPGYFGKVGMRVFHLNK 65

Human    66 NQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLPKQPVIVKAKFFS 130
            ||.:|||||:::||:||.::.|..|.   .|.:|:||..:.||:||||||.||:.|:||||:|||
 Worm    66 NQHYCPTVNVERLWSLVPQEVRDKAT---GGKSPVIDCTKLGYFKVLGKGLLPETPLIVKARFFS 127

Human   131 RRAEEKIKSVGGACVLVA 148
            ..||:|||..||||||||
 Worm   128 HEAEQKIKKAGGACVLVA 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RPL27ANP_000981.1 PTZ00160 1..148 CDD:185489 101/146 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38 33/36 (92%)
Y37E3.8NP_490927.1 PTZ00160 1..145 CDD:185489 101/146 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161453881
Domainoid 1 1.000 171 1.000 Domainoid score I2517
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H115477
Inparanoid 1 1.050 225 1.000 Inparanoid score I2554
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53607
OrthoDB 1 1.010 - - D1445443at2759
OrthoFinder 1 1.000 - - FOG0001387
OrthoInspector 1 1.000 - - oto21364
orthoMCL 1 0.900 - - OOG6_100748
Panther 1 1.100 - - LDO PTHR11721
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1123
SonicParanoid 1 1.000 - - X1116
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.940

Return to query results.
Submit another query.