DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RPL24 and RpL24

DIOPT Version :9

Sequence 1:NP_000977.1 Gene:RPL24 / 6152 HGNCID:10325 Length:157 Species:Homo sapiens
Sequence 2:NP_001285895.1 Gene:RpL24 / 34754 FlyBaseID:FBgn0032518 Length:155 Species:Drosophila melanogaster


Alignment Length:158 Identity:105/158 - (66%)
Similarity:125/158 - (79%) Gaps:4/158 - (2%)


- Green bases have known domain annotations that are detailed below.


Human     1 MKVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHKKGQSE 65
            ||:.||:|||||||||||:...:.|||.|.||:.|||.::|.|||||::.|||||||||:||..|
  Fly     1 MKIGLCAFSGYKIYPGHGKTMVKIDGKSFTFLDKKCERSYLMKRNPRKVTWTVLYRRKHRKGIEE 65

Human    66 EIQKKRTRRAVKFQRAITGASLADIMAKRNQKPEVRKAQREQAIRAAKEAKKAKQASKKTAMAAA 130
            |..||||||..||||||.|||||:|:||||.|||||||||:|||:.|||.|:|.:|:||   |||
  Fly    66 EASKKRTRRTQKFQRAIVGASLAEILAKRNMKPEVRKAQRDQAIKVAKEQKRAVKAAKK---AAA 127

Human   131 KAPT-KAAPKQKIVKPVKVSAPRVGGKR 157
            .||. |:|||||..|..:.:||||||||
  Fly   128 PAPAKKSAPKQKAAKVTQKAAPRVGGKR 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RPL24NP_000977.1 Ribosomal_L24e 2..64 CDD:395998 40/61 (66%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 106..157 29/51 (57%)
RpL24NP_001285895.1 Ribosomal_L24e 2..63 CDD:395998 39/60 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159152
Domainoid 1 1.000 112 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E1_COG2075
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H763
Inparanoid 1 1.050 208 1.000 Inparanoid score I3691
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53708
OrthoDB 1 1.010 - - D1502432at2759
OrthoFinder 1 1.000 - - FOG0002767
OrthoInspector 1 1.000 - - oto88291
orthoMCL 1 0.900 - - OOG6_101189
Panther 1 1.100 - - LDO PTHR10792
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1120
SonicParanoid 1 1.000 - - X1853
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.