DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RPL6 and RpL6

DIOPT Version :9

Sequence 1:NP_000961.2 Gene:RPL6 / 6128 HGNCID:10362 Length:288 Species:Homo sapiens
Sequence 2:NP_651876.1 Gene:RpL6 / 43723 FlyBaseID:FBgn0039857 Length:262 Species:Drosophila melanogaster


Alignment Length:270 Identity:127/270 - (47%)
Similarity:170/270 - (62%) Gaps:19/270 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    27 VKKGNLKAKKPKKGKPHCSRNPVLVRGIGRYSRSAMYSRKAMYKRKYSAAKSKVEKK----KKEK 87
            ::|....||..||||.| ..|..|..||.|||::.||.|:|:|:.|        :||    :|.|
  Fly     4 IEKAKKVAKSAKKGKKH-PVNSYLKGGILRYSKAQMYKRRALYRLK--------DKKSPVVEKAK 59

Human    88 VLATVTKPVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRKLRASITPGTILII 152
            |.....|.:||.||||.|.|.|:|....|||:...:|..|  |..||:|.|..|.::||||:||:
  Fly    60 VPIKKVKKIGGPKNGGERTVFLKKSKASYPTKTFVKKRPS--KANFSEHKRNTRRNLTPGTVLIL 122

Human   153 LTGRHRGKRVVFLKQLASGLLLVTGPLVLNRVPLRRTHQKFVIATSTKIDISNVKIPKHLTDAYF 217
            |.|||:|||||.||.|||||||||||..||..||||..|::||.||:|:|:...|:|:||.||||
  Fly   123 LAGRHQGKRVVLLKVLASGLLLVTGPFALNSCPLRRVSQRYVIGTSSKVDLGAFKVPEHLNDAYF 187

Human   218 KKKKLRKPRHQ-EGEIFDTEKEKYEITEQRKIDQKAVDSQILPKIKAIPQ---LQGYLRSVFALT 278
            ::.|.:|.:.. |.:||..:||::...||||.|||.||:.:|..|||.|:   ...||:::|||.
  Fly   188 RRLKAKKDKKTGEADIFAAKKERFVPNEQRKKDQKEVDAALLKVIKAHPEGKFFAKYLQNMFALH 252

Human   279 NGIYPHKLVF 288
            :..|||::.|
  Fly   253 SSQYPHRMRF 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RPL6NP_000961.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48 8/20 (40%)
Ribosomal_L6e_N 36..95 CDD:397788 23/62 (37%)
KOW_RPL6 136..288 CDD:240520 81/155 (52%)
RpL6NP_651876.1 Ribosomal_L6e_N <23..>51 CDD:281813 13/35 (37%)
KOW_RPL6 106..262 CDD:240520 81/155 (52%)
RPL14A 111..234 CDD:225074 68/122 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140648
Domainoid 1 1.000 99 1.000 Domainoid score I7132
eggNOG 1 0.900 - - E1_COG2163
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31001
Inparanoid 1 1.050 220 1.000 Inparanoid score I3572
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53785
OrthoDB 1 1.010 - - D1227453at2759
OrthoFinder 1 1.000 - - FOG0001826
OrthoInspector 1 1.000 - - oto91069
orthoMCL 1 0.900 - - OOG6_101188
Panther 1 1.100 - - LDO PTHR10715
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1143
SonicParanoid 1 1.000 - - X1520
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.