DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RPA2 and RPA2

DIOPT Version :9

Sequence 1:NP_001284487.1 Gene:RPA2 / 6118 HGNCID:10290 Length:278 Species:Homo sapiens
Sequence 2:NP_001260652.1 Gene:RPA2 / 35364 FlyBaseID:FBgn0032906 Length:246 Species:Drosophila melanogaster


Alignment Length:249 Identity:77/249 - (30%)
Similarity:123/249 - (49%) Gaps:15/249 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    33 GGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVEI-----SQVTIVGIIRHAE 92
            |.|.:...:.....|..:.:.|||..:.|::.|.       .||:|:     :...:|.|:|:.|
  Fly     6 GDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAP-------EGNIELFGMQYAMACVVAIVRNVE 63

Human    93 KAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPL 157
            .:.|.|.|.::|.:.. :|...|::..|......|: ...||||.|..||....|:|:.||::|:
  Fly    64 TSSTKITYTLEDHSGR-IDAHYWLEEGDALKAPEVM-VNNYVKVYGTTRSQGGSKTLMIFKLLPV 126

Human   158 EDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNF-GGNSFMPANGLTVAQNQVL 221
            .|.||..||:|||:||........|:..||....::.|.....:| ...|....:||...|..|.
  Fly   127 LDPNEVCTHLLEVLNARYRAEDYQSKGGAGAGAGASSGSGSIADFTASQSSAIVSGLEPKQQAVF 191

Human   222 NLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKST 275
            ..||:....||::.::||.:..|:|.|.:...:||:.:||||||::|.|||..|
  Fly   192 QAIKSNVSEEGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICT 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RPA2NP_001284487.1 RFA2 33..275 CDD:227560 76/247 (31%)
RPA2_DBD_D 81..175 CDD:239924 34/93 (37%)
RPA_C 174..270 CDD:285937 28/96 (29%)
RPA2NP_001260652.1 RFA2 12..246 CDD:227560 73/239 (31%)
RPA2_DBD_D 52..144 CDD:239924 31/96 (32%)
RPA_C <182..238 CDD:285937 19/55 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9348
eggNOG 1 0.900 - - E1_COG5235
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37712
Inparanoid 1 1.050 121 1.000 Inparanoid score I4757
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58029
OrthoDB 1 1.010 - - D561832at33208
OrthoFinder 1 1.000 - - FOG0003638
OrthoInspector 1 1.000 - - otm42288
orthoMCL 1 0.900 - - OOG6_102423
Panther 1 1.100 - - LDO PTHR13989
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4625
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.