DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OPN1SW and ninaE

DIOPT Version :9

Sequence 1:NP_001372054.1 Gene:OPN1SW / 611 HGNCID:1012 Length:345 Species:Homo sapiens
Sequence 2:NP_524407.1 Gene:ninaE / 42367 FlyBaseID:FBgn0002940 Length:373 Species:Drosophila melanogaster


Alignment Length:331 Identity:91/331 - (27%)
Similarity:153/331 - (46%) Gaps:37/331 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    27 PVWAFYLQAAFMGTVFLIGFPLNAMVLVATLRYKKLRQPLNYILVNVSFGGFLLCIFSVFPVFVA 91
            |:||..| .|:|..:.:|.:..|.:|:......|.||.|.|.:::|::...|.:.|.:. |:.  
  Fly    47 PIWAKIL-TAYMIMIGMISWCGNGVVIYIFATTKSLRTPANLLVINLAISDFGIMITNT-PMM-- 107

Human    92 SCNGYF---VFGRHVCALEGFLGTVAGLVTGWSLAFLAFERYIVICKPFGNFRFSSKHALTVVLA 153
            ..|.||   |.|..:|.:...||:..|..:.||:..::.:||.||.|.......:...||..:..
  Fly   108 GINLYFETWVLGPMMCDIYAGLGSAFGCSSIWSMCMISLDRYQVIVKGMAGRPMTIPLALGKIAY 172

Human   154 TWTIGIGVSIPPFFGWSRFIPEGLQCSCGPDWYTVGTKYRSESYTWFLFIFCFIVPLSLICFSYT 218
            .|.:.....:.|.|||||::|||...|||.|:  :...:...||..|..||.:.:||.|||:||.
  Fly   173 IWFMSSIWCLAPAFGWSRYVPEGNLTSCGIDY--LERDWNPRSYLIFYSIFVYYIPLFLICYSYW 235

Human   219 QLLRALKAVAAQQQESA-------------TTQKAEREVSRMVVVMVGSFCVCYVPYAAFAMYMV 270
            .::.|:.|.....:|.|             ..:.||.:::::.:|.:..:.:.:.|      |:|
  Fly   236 FIIAAVSAHEKAMREQAKKMNVKSLRSSEDAEKSAEGKLAKVALVTITLWFMAWTP------YLV 294

Human   271 NN-----RNHGLDLRLVTIPSFFSKSACIYNPIIYCFMNKQFQACIMK----MVCGKAMTDESDT 326
            .|     :..||........:.|:|||..||||:|...:.:::..:.:    .|.||....:|..
  Fly   295 INCMGLFKFEGLTPLNTIWGACFAKSAACYNPIVYGISHPKYRLALKEKCPCCVFGKVDDGKSSD 359

Human   327 CSSQKT 332
            ..||.|
  Fly   360 AQSQAT 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OPN1SWNP_001372054.1 7tmA_SWS1_opsin 32..311 CDD:320204 81/299 (27%)
TM helix 1 34..58 CDD:320204 5/23 (22%)
TM helix 2 67..89 CDD:320204 5/21 (24%)
TM helix 3 105..127 CDD:320204 5/21 (24%)
TM helix 4 149..165 CDD:320204 1/15 (7%)
TM helix 5 195..218 CDD:320204 11/22 (50%)
TM helix 6 245..267 CDD:320204 2/21 (10%)
TM helix 7 279..304 CDD:320204 9/24 (38%)
ninaENP_524407.1 7tmA_photoreceptors_insect 52..340 CDD:320207 81/299 (27%)
TM helix 1 53..77 CDD:320207 6/24 (25%)
TM helix 2 86..108 CDD:320207 5/24 (21%)
TM helix 3 124..146 CDD:320207 5/21 (24%)
TM helix 4 168..184 CDD:320207 1/15 (7%)
TM helix 5 212..235 CDD:320207 11/22 (50%)
TM helix 6 275..297 CDD:320207 4/27 (15%)
TM helix 7 308..333 CDD:320207 9/24 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X120
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.