DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ROBO1 and Dscam3

DIOPT Version :10

Sequence 1:XP_011532278.1 Gene:ROBO1 / 6091 HGNCID:10249 Length:1654 Species:Homo sapiens
Sequence 2:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster


Alignment Length:1848 Identity:390/1848 - (21%)
Similarity:595/1848 - (32%) Gaps:580/1848 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    59 SRLRQEDFPPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGERVETDKDDPRSHRMLL- 122
            :.|:..|..|.::....:..|..|...:|.|.|.|.|.|...|....:.:   .|....||..: 
  Fly   430 AELKLGDTVPELIYTFIEQNVRPGPLISLKCSASGSPPPQFAWLLDSQPI---MDVSLHHRFAIG 491

Human   123 ----PSGSLF-FLRIVHGRKSRPDE-GVYVCVARNYLGEAVSHNASLEV-------AILRDDFRQ 174
                .||.:. .|.|.|   .|||: |:|.|||.|.:| :|.|:|.|.|       ||       
  Fly   492 QFVDMSGDVISHLNISH---VRPDDGGLYKCVASNSMG-SVQHSARLNVYGPPYVRAI------- 545

Human   175 NPSDVMVAVGEPAVMECQPPRGHPEPTISWKKDGSPLDDKD--ERITIR-GGKLMITYTRKS-DA 235
              ..:....||..::.| |..|:|...|.|:|....|...:  |..::. ||:|:|...... |.
  Fly   546 --GPIKAVAGEDIIVHC-PFAGYPVEQIRWEKAHQELTTSNHYELASVADGGQLVIKNVEPGRDQ 607

Human   236 GKYVCVGTNMVGERESEVAELTVLERPSF--VKRPSNLAVTVDDSAEFKCEARGDPVPT-VRWRK 297
            |.|.|:..:..||......:|.|...|..  .|.|.||  .....|:..|......:|. ..|:|
  Fly   608 GIYTCIVRSRAGEEARRDMQLNVNSPPVIEPFKFPKNL--QEGGRAQITCAVSSGDMPIYFSWKK 670

Human   298 DDGELPKSRY--EIRDD--HTLKIRKVTAGDMGSYTCVAENMVGKAEASATLTVQVGSEPPHFVV 358
            ||..:|.|..  |.:::  ..|..:.::|...|.|||.|.|...|...:|.|.|:|.   |.:..
  Fly   671 DDSSIPSSLQITEKKEEFYSLLVFKDISARHSGKYTCYASNAAAKVNYTAELQVRVA---PRWRY 732

Human   359 KPRDQVVALGRTVTFQCEATGNPQPAIFW---RREGSQNLLFSYQPPQSSSRFSVSQTGDLTITN 420
            :|.|..:.||.|::..|||.|.|.|.|.|   :.:||::.     .|.|....|      |.:..
  Fly   733 EPMDTAIMLGNTISINCEAEGYPIPTITWFKGQGKGSKDF-----KPLSMRNHS------LLLNL 786

Human   421 VQRSDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPVIRQGPVNQTVAVDGTFVLSCVATGSP 485
            ...:|.|||:||..|..|     |.|:.|..|....|....|...|.:...:....|.|.|.|..
  Fly   787 ATDNDEGYYMCQATNEIG-----AGLKKTIRINVNEPARFEQSARNISSRRNDPVTLDCHAKGDE 846

Human   486 VPTILWRKDGVLVSTQDSRIK----QLENGV---LQIRYAKLGDTGRYTCIASTPSGEATWSAYI 543
            ..||.|.::...:...:.|..    :.|.||   |.|.::...|:|.|.|||..|.|.|....::
  Fly   847 PITIGWTQNNGRIDLNNFRFSIAEMKTEKGVDSQLTIGHSDRHDSGVYRCIAENPYGRAEQIIFL 911

Human   544 EVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGATPTSYIIE------AF 602
            .|||               .|..||..|:.:|...||.|||:...:..:...||:::      ..
  Fly   912 AVQE---------------RPDTPSHLEIFEVGSRTVKLSWRRPFDGNSPVLSYLVQYQALKYLQ 961

Human   603 SH----ASGSSWQTVAENVK--------------TETSAIKGLKPNAIYLFLVRAANAYGISDPS 649
            ||    |:|..|.....||.              .|::.:.||.|...:|..::|.|..   :.|
  Fly   962 SHGSLAAAGGDWNGHVINVSLPSTSISRSYDSDLRESAIVAGLTPATTFLIRMQAINEI---ERS 1023

Human   650 QISDPV--KTQDVLPTSQGVDHKQVQRELGNAVLHLHNPTVLSSSSIEVHWTVDQQSQYIQGYKI 712
            ..::.:  |||:..||..   ...||.:.|            ..|.:.|.|.:..:..: .|..|
  Fly  1024 AYTEAIVLKTQEEAPTEA---PSNVQVQTG------------GESELIVTWQIPPRESW-NGELI 1072

Human   713 LYRPSGANHGESDWLVFEVRTPAKNSVV---------IPDLRKGVNYEIKARPFFNEFQGADSEI 768
            .|..:.:...::...:..|.:..|:::|         :..|||...|.:..|...:...|..|..
  Fly  1073 GYTVNCSEEKQNINFISVVNSSLKSTIVSGWATTKATLRGLRKYSRYAVTIRAMNSFGSGPWSAA 1137

Human   769 KFAKTLEEAPSAPPQGVTVSKNDGNGTA-----ILVSWQPPPEDTQNGMVQEYK------VWCLG 822
            .|..|.|..|.|.||.|       |.||     :.:||..||.....|::|.||      |..:.
  Fly  1138 IFGTTAEGVPEAAPQNV-------NCTALSSQSLKISWLEPPLQFHGGIIQGYKILYRPIVHQID 1195

Human   823 NETRYHINKTVDGSTFSVVIPFLVPGIRYSVEVAASTGAGSGVKSEPQFIQLDAHGNPVSPEDQV 887
            ...:..|.:|   |.....:..|.....||:.|.|.|..|.|:.|.|.|.|.|            
  Fly  1196 FPAKLEIKRT---SNLETYLHTLHKASNYSIRVLAYTATGDGLASHPLFCQTD------------ 1245

Human   888 SLAQQISDVVKQPAFIAGIGAACWIILMVFSIWLYRHRKKRNGLTSTY------AGIRKVPSFTF 946
                  .||...|   |.|.||......:...||  ..|.|||:.|.|      ||         
  Fly  1246 ------DDVPDAP---AAIKAAALTADSILISWL--TPKNRNGIISHYTVYSREAG--------- 1290

Human   947 TPTVTYQRGGEA------VSSGGRPGLLNISEPAAQPWLADTWPNTGNNHND------------- 992
                   |.|:|      |...|.|.... |...|:..:.:.|.:...:..:             
  Fly  1291 -------RKGQAKTHMVRVDENGYPVTFE-SRSLAENQMYEFWVSASTSVGEGEPTSVIAQATNT 1347

Human   993 --------------------CSISCCTAGNGNSDSNLTTYSRPADC-----IANYNNQLDNK--- 1029
                                ..:.|...||....:...|..||...     :.|..|...::   
  Fly  1348 RAPARIASFGQVVRKAVGTGLVLECLAVGNPTPRARWLTRDRPVTFSPFYEVTNEGNLKIHRVEG 1412

Human  1030 --QTNLMLPESTVYGDVDLSNKINEMKTFNSPNL-----------------KDGRFVNPSGQP-- 1073
              ..|.....:.::|..::..::..||..::|.:                 .||      |.|  
  Fly  1413 SLSGNYTCTANNLFGSDEIQYQVIAMKPPSAPQIIVQYASADSIRVSWDAPDDG------GAPLQ 1471

Human  1074 ----------TPYATTQLIQSN-----------------LSNNMNNGSGDSGEKHWKPLGQQKQE 1111
                      ..::.|:|:..|                 :|.:...|||                
  Fly  1472 GYTISYHTAGESWSITELLPENNAFTISGLKCGNQYIIKMSAHNMVGSG---------------- 1520

Human  1112 VAPVQYNIVEQNKLNKDYRANDTVPPT---IPYNQSYDQNTGGSYNSSDRGSSTSGSQGHKKGAR 1173
            ||..:.|:..:.|.::...||:.:...   :....|..||.|.|.:             |.....
  Fly  1521 VASEEINVWTKGKASQAPNANELIATNATCVNLKLSSWQNGGCSIH-------------HFSIEH 1572

Human  1174 TPKVPKQGGMNW----ADLLPPPPAHPPPHSNSEEYNISVDESYDQEMPCPVPPARMY-----LQ 1229
            .|    .|.:.|    :|:           ||:|       |:.:..:.|...||:.|     ..
  Fly  1573 RP----LGDIRWTVVTSDI-----------SNAE-------ENRENLIFCDFLPAKWYQLRISAT 1615

Human  1230 QDELEEEEDERGPTPPVRGAASSPAAVSYSHQS-------------------------------T 1263
            .|..:..|.....|..:.|....|.:|..|...                               |
  Fly  1616 NDAGKTTEHYHFSTTNIDGITIPPPSVFPSENDLMNNLINSTNPTSGDWFATLIVVVIITVSIIT 1680

Human  1264 ATLTPSPQEEL-QPMLQDCPEET---GHMQHQPDRRRQPVSPPPPPR-----------PISPPHT 1313
            ..||...:..| .|:.:.....|   .:.:...:||.|.|....|.:           .|||..|
  Fly  1681 IALTIKHRRTLCGPIAEGYESRTLPGDYKEDHENRRNQQVYSASPVKTVDKGNESEMYEISPYAT 1745

Human  1314 YGYISGPLVSDMDTDAPEEEEDEADMEVAKMQTRRLLLR------------------GLEQT--- 1357
            :....|      .|.||           ||..||.:..:                  .|..|   
  Fly  1746 FSVNGG------RTGAP-----------AKTPTRAVAAQTPLDYTMQFKTFGHPEGENLNATAYP 1793

Human  1358 --PASSVGDLESSVTGSMINGWG-----SASEEDNISSGRSSVSSSDGSFFTDADFAQAVAAAAE 1415
              |:|..|.::|.      :.|.     :..:|..:|...:.|:.|.......::..::..::|.
  Fly  1794 LLPSSGFGHVKSK------SSWHKQRYYNTEDESTLSKSMTIVAGSQAGHSKKSNGGRSAKSSAA 1852

Human  1416 YAGLKVARRQMQDAAGRRHFHASQCPRPTSPVSTDSNMSAAVMQKTRPAKKLKHQPGHLRRETYT 1480
            .:|:         .||      |:.....||.:..|||                           
  Fly  1853 CSGV---------VAG------SESDTSISPSTEFSNM--------------------------- 1875

Human  1481 DDLPPPPVPPPAIKSPTAQSKTQLEVRPVVVPKLPSMDARTDRSSDRKGSSYKGREVLDGRQVVD 1545
                      |..:.|                      .::.|||             |||.|||
  Fly  1876 ----------PTYRVP----------------------CKSSRSS-------------DGRAVVD 1895

Human  1546 MRTNPGDPREAQEQQNDGKGRGNKAAKRDLPPAKTHLIQEDILPYCRPT---------FPTSNNP 1601
            |..    |..:.|..||   :|:.|      |.:.|.....:|......         ....|.|
  Fly  1896 MFR----PDSSTESNND---QGSPA------PERRHNTPRHVLGMGMAMGLGGGGGGGVGGGNGP 1947

Human  1602 RDPSSSSSMSSR-GSGSRQREQANVGRR 1628
            .:..|:...|.: ||.::|.....:.||
  Fly  1948 AEKRSAGQRSRKHGSAAQQPSNQTLERR 1975

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ROBO1XP_011532278.1 IgC_1_Robo 68..166 CDD:409490 33/111 (30%)
Ig strand A 68..72 CDD:409490 1/3 (33%)
Ig strand A' 75..80 CDD:409490 0/4 (0%)
Ig strand B 84..92 CDD:409490 2/7 (29%)
Ig strand C 98..103 CDD:409490 1/4 (25%)
Ig strand C' 106..108 CDD:409490 0/1 (0%)
Ig strand D 119..122 CDD:409490 1/2 (50%)
Ig strand E 125..131 CDD:409490 1/6 (17%)
Ig strand F 143..151 CDD:409490 5/7 (71%)
Ig strand G 154..166 CDD:409490 6/18 (33%)
IgI_2_Robo 173..258 CDD:409389 22/88 (25%)
Ig strand A 173..176 CDD:409389 0/2 (0%)
Ig strand A' 178..182 CDD:409389 0/3 (0%)
Ig strand B 186..193 CDD:409389 1/6 (17%)
Ig strand C 201..206 CDD:409389 2/4 (50%)
Ig strand C' 208..211 CDD:409389 0/2 (0%)
Ig strand D 217..221 CDD:409389 0/3 (0%)
Ig strand E 223..229 CDD:409389 3/5 (60%)
Ig strand F 236..244 CDD:409389 3/7 (43%)
Ig strand G 247..258 CDD:409389 3/10 (30%)
IgI_3_Robo 265..347 CDD:409390 25/86 (29%)
Ig strand A 265..268 CDD:409390 1/2 (50%)
Ig strand A' 270..274 CDD:409390 2/3 (67%)
Ig strand B 277..286 CDD:409390 2/8 (25%)
Ig strand C 292..297 CDD:409390 1/5 (20%)
Ig strand C' 300..303 CDD:409390 0/2 (0%)
Ig strand D 306..311 CDD:409390 1/6 (17%)
Ig strand E 312..319 CDD:409390 1/8 (13%)
Ig strand F 326..334 CDD:409390 5/7 (71%)
Ig strand G 337..347 CDD:409390 3/9 (33%)
IgI_4_Robo 355..452 CDD:409391 30/99 (30%)
Ig strand A 355..359 CDD:409391 0/3 (0%)
Ig strand A' 361..365 CDD:409391 1/3 (33%)
Ig strand B 371..379 CDD:409391 3/7 (43%)
Ig strand C 382..389 CDD:409391 3/9 (33%)
Ig strand C' 391..394 CDD:409391 2/2 (100%)
Ig strand D 407..412 CDD:409391 1/4 (25%)
Ig strand E 414..421 CDD:409391 1/6 (17%)
Ig strand F 427..436 CDD:409391 5/8 (63%)
FN3 428..882 CDD:442628 125/506 (25%)
Ig strand G 438..449 CDD:409391 3/10 (30%)
IgI_5_Robo 459..545 CDD:409544 24/92 (26%)
Ig strand A 459..462 CDD:409544 0/2 (0%)
Ig strand A' 466..469 CDD:409544 1/2 (50%)
Ig strand B 475..482 CDD:409544 2/6 (33%)
Ig strand C 488..493 CDD:409544 3/4 (75%)
Ig strand C' 495..497 CDD:409544 0/1 (0%)
Ig strand D 504..508 CDD:409544 1/7 (14%)
Ig strand E 511..516 CDD:409544 3/7 (43%)
Ig strand F 524..532 CDD:409544 5/7 (71%)
Ig strand G 535..545 CDD:409544 2/9 (22%)
FN3 564..650 CDD:238020 26/109 (24%)
Dscam3NP_996226.2 Ig 38..135 CDD:472250
Ig strand B 56..60 CDD:409353
Ig strand C 69..73 CDD:409353
Ig strand E 93..97 CDD:409353
Ig strand F 113..118 CDD:409353
Ig strand G 126..130 CDD:409353
Ig 246..337 CDD:472250
Ig strand B 264..268 CDD:409353
Ig strand C 277..281 CDD:409353
Ig strand E 303..307 CDD:409353
Ig strand F 317..322 CDD:409353
Ig strand G 330..333 CDD:409353
Ig 341..434 CDD:472250 1/3 (33%)
Ig strand B 358..362 CDD:409353
Ig strand C 371..375 CDD:409353
Ig strand E 400..404 CDD:409353
Ig strand F 414..419 CDD:409353
Ig strand G 427..430 CDD:409353 390/1848 (21%)
IgI_4_Dscam 439..536 CDD:409548 32/103 (31%)
Ig strand A' 447..451 CDD:409548 0/3 (0%)
Ig strand B 454..463 CDD:409548 2/8 (25%)
Ig strand C 468..474 CDD:409548 2/5 (40%)
Ig strand C' 476..479 CDD:409548 0/2 (0%)
Ig strand D 487..495 CDD:409548 1/7 (14%)
Ig strand E 499..508 CDD:409548 2/8 (25%)
Ig strand F 515..523 CDD:409548 5/7 (71%)
Ig strand G 526..536 CDD:409548 5/10 (50%)
Ig 539..630 CDD:472250 24/100 (24%)
Ig strand B 556..560 CDD:409353 0/3 (0%)
Ig strand C 569..573 CDD:409353 1/3 (33%)
Ig strand E 594..598 CDD:409353 2/3 (67%)
Ig strand F 609..614 CDD:409353 2/4 (50%)
Ig strand G 623..626 CDD:409353 0/2 (0%)
Ig 633..724 CDD:472250 26/92 (28%)
Ig strand B 651..655 CDD:409353 1/3 (33%)
Ig strand C 665..669 CDD:409353 0/3 (0%)
Ig strand E 690..694 CDD:409353 1/3 (33%)
Ig strand F 704..709 CDD:409353 3/4 (75%)
Ig strand G 717..720 CDD:409353 0/2 (0%)
Ig 728..815 CDD:472250 32/102 (31%)
Ig strand B 745..749 CDD:409353 0/3 (0%)
Ig strand C 758..762 CDD:409353 1/3 (33%)
Ig strand E 780..784 CDD:409353 2/9 (22%)
Ig strand F 794..799 CDD:409353 3/4 (75%)
Ig strand G 808..811 CDD:409353 0/2 (0%)
Ig 820..913 CDD:472250 24/92 (26%)
Ig strand C 849..853 CDD:409353 2/3 (67%)
Ig strand E 879..883 CDD:409353 1/3 (33%)
Ig strand F 893..898 CDD:409353 2/4 (50%)
Ig strand G 906..909 CDD:409353 0/2 (0%)
FN3 <940..1417 CDD:442628 111/545 (20%)
Ig 1355..1430 CDD:472250 10/74 (14%)
Ig strand B 1368..1372 CDD:409353 0/3 (0%)
Ig strand C 1381..1385 CDD:409353 0/3 (0%)
Ig strand E 1403..1407 CDD:409353 1/3 (33%)
Ig strand F 1417..1422 CDD:409353 1/4 (25%)
Ig strand G 1430..1433 CDD:409353 0/2 (0%)
FN3 1441..1530 CDD:238020 15/110 (14%)
FN3 1542..1620 CDD:238020 19/112 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.