DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ROBO1 and Cont

DIOPT Version :10

Sequence 1:XP_011532278.1 Gene:ROBO1 / 6091 HGNCID:10249 Length:1654 Species:Homo sapiens
Sequence 2:NP_649461.2 Gene:Cont / 40553 FlyBaseID:FBgn0037240 Length:1390 Species:Drosophila melanogaster


Alignment Length:1161 Identity:250/1161 - (21%)
Similarity:412/1161 - (35%) Gaps:271/1161 - (23%)


- Green bases have known domain annotations that are detailed below.


Human     2 KWKHVP-FLVMISLLSLSPNHLFLAQLIPDPEDVERGNDHGTPIPTSDNDDNSLGYTGSRLRQED 65
            :|..:| :.:.::|.......|:.:..:....|.:|...:|..|    ||            .|.
  Fly   309 RWMFMPAYEIELNLFICESKVLYSSDNVNIKLDDKRPYHYGLDI----ND------------MER 357

Human    66 FP--PRIVEHPSDLI--VSKG---EPATLNCKAEGRPTPTIEWYKG---GERVETDKDDPRSH-R 119
            .|  |..|:.|:|..  |:|.   ...||:|.|.|.|||:..||:.   .:|:|..|.||.:. |
  Fly   358 IPRGPYFVKQPNDTTFDVNKNRLINDVTLSCLANGYPTPSYTWYREVYVDDRLEYQKIDPLAQDR 422

Human   120 MLLPSGSLFFLRIVHGRKSRPDEGVYVCVARNYLGEAVSHNASLEVAILRDDFRQNPSDVMVAVG 184
            ..:..|:|    |::..|...|:|.|.|||.|..|...|.:|.|....:. :|....|.....:.
  Fly   423 YTISGGNL----IIYEPKQALDQGAYHCVAENKFGRIRSESAHLNFGFIM-EFNLKRSAETSEMN 482

Human   185 EPAVMECQPPRGHPEPTISWKKDGSP-LDDKDERITI-RGGKLMITYTRKSDAGKYVCVGTNMVG 247
            ....:.|.||:.:|:....|.:|..| ..::|:|:.: |.|.|..::....|...|.|....:|.
  Fly   483 WGKSIFCDPPQHYPDVRYYWARDYFPNFVEEDQRVFVSRDGALYFSFIETVDRANYSCTVQTLVS 547

Human   248 ERESEVAELTVLERPSF---VKRPSNL---------------AVTVDDSAEFKCEARGDPVPTVR 294
            :        |....|.|   |...||.               |....|....:|.|.|.|:|:..
  Fly   548 D--------TGRNGPFFPLRVTPNSNYQALIFANTFPKVFPEAPVAGDEIRLECMAFGYPIPSYN 604

Human   295 WRKDDGELPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGKAEASATLTVQVGSEPPHFVVK 359
            |.:....|.::.|.|.....|.|:..|..|.|.|:|...|.......|..:.:|:   .|.|.:.
  Fly   605 WTRQGLPLQRNAYTINYGRVLIIQNATTNDNGEYSCTITNPRKTLMKSIYINIQM---RPQFTIP 666

Human   360 PRDQVVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSVSQTGDLTITNVQR- 423
            .:|.:......|||.|||...|.....|.:...:     ..|...:....:.|...|||..::: 
  Fly   667 LKDMIKDYNSDVTFICEAFAIPDANYTWYKNAER-----LDPANINRDRYIIQDNVLTIKFLEKD 726

Human   424 SDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPVIRQGPVNQTV--AVDGTFVLSCVATGSPV 486
            .|...|.|...|...:..:.|.|.|..:     .|..::.|:...|  ..:|...:.|....:|.
  Fly   727 KDDAMYQCGAQNQLKTSFSSAQLRVLSM-----KPSFKKHPLESEVYAVYNGNTTIVCDPEAAPR 786

Human   487 PTILWRKDGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSG-EATWSAYIEVQEFGV 550
            |...|:|||.::.:...| :.|.:|.|.|......|.|.||||||..:| :.:.:..|.:||...
  Fly   787 PKFQWKKDGQVIGSGGHR-RILPSGTLTISPTSRDDEGIYTCIASNQAGTDESHARVIVLQEIRF 850

Human   551 PVQPPR---PTDPNLI------------------------------------------------- 563
            ...||:   ..:.:||                                                 
  Fly   851 IETPPQRIVSKEHDLIFLHCEAAFDELLDIAYVWKHNGEVLKNNHDGTGRIIVDWNRLTVHNTSM 915

Human   564 ----------------------------PSAPSKPEVTDVSRNTVTLSWQPNLNSGATPTSYIIE 600
                                        |.||...:|..:|:....:.|....::|..     |.
  Fly   916 RDAGDYECVVKSAVNEISSKTSVSIEGAPGAPGGVQVIQISKTKAIIEWVDGSHNGRA-----IR 975

Human   601 AFSHASGSSWQTVAENVKTETSA-------------IKGLKPNAIYLFLVRAANAYGISDPSQIS 652
            .::....::|.....||.|...|             :..|.|.:.|.|.|.|.|..||..||..|
  Fly   976 YYNILGRTNWNRTWVNVSTHVQAREVDRYTSRQQAEVVNLTPWSAYEFSVTAVNDLGIGTPSAPS 1040

Human   653 DPVKTQD----VLPTSQGVDHKQVQRELGNAVLHLHNPTVLSSSSIEVHW-TVDQQSQYIQG--Y 710
            ....|.:    :.|.:.|....::                   ..:.:.| .:..|.|:..|  |
  Fly  1041 PIYSTYEDKPYIAPRNVGGGGGKI-------------------GDLTITWDPLLPQEQHSHGIHY 1086

Human   711 KILYRPSGANHGESDWLVFEVRTPAKNSVVIPDLRKG---VNYEIKARPFFNEFQGADSEIKFAK 772
            |:.::..||    .:|...|::......|.:.::...   ..||:|.:...:..:|.:|||....
  Fly  1087 KVFWKLKGA----IEWASDEIKKQDHMGVAVVNIPLNNYYTEYEVKVQAINSVGKGPESEIAVIH 1147

Human   773 TLEEAPS-APPQGVTVSKNDGNGTAILVSWQPPPEDTQN--GMV--QEYKVWCLGNETR---YHI 829
            :.|:.|. ||.:.:.::.   |.|...|:|||.....:|  |.:  ...|.|...::..   |::
  Fly  1148 SAEDMPQVAPQKPIALAY---NSTCFNVTWQPIDMSRENIRGKLIGHRLKYWKTTHQEEDSVYYL 1209

Human   830 NKTVDGSTFSVVIPFLVPGIRYSVEVAASTGAGSGVKSE----------PQFIQLDAHGNPVSPE 884
            ::|.  ..:::::. |.|...|.|:|.|...||.|.:||          ||......|...::|.
  Fly  1210 SRTT--RNWALIVG-LQPDTYYFVKVMAYNAAGEGPESERFEERTYRKAPQKPPSSVHVYGINPS 1271

Human   885 D------QVSLAQQISDVVKQPAFIAGIGAACWIILMVFSIWLYRHRKKRNGLTSTYAGI---RK 940
            .      .||.:|.     ::|  :.|.....|             ...:|.:|:....:   :|
  Fly  1272 TVRVVWRYVSPSQD-----EEP--VEGYKVRIW-------------ESDQNMITANNTIVPIGQK 1316

Human   941 VPSF--TFTPTVTYQRGGEAVSSGGRPGLLNISEPAAQPWLADT---WPNTGNNHN 991
            :.|:  ..||..:|.....|.|:||..   .:|.|.....:..|   ..||.:.||
  Fly  1317 LESYINNLTPGKSYNMRVLAYSNGGDG---RMSSPTLHFQMGKTTRNGANTRHGHN 1369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ROBO1XP_011532278.1 IgC_1_Robo 68..166 CDD:409490 37/106 (35%)
Ig strand A 68..72 CDD:409490 1/3 (33%)
Ig strand A' 75..80 CDD:409490 1/6 (17%)
Ig strand B 84..92 CDD:409490 3/7 (43%)
Ig strand C 98..103 CDD:409490 1/4 (25%)
Ig strand C' 106..108 CDD:409490 0/1 (0%)
Ig strand D 119..122 CDD:409490 1/2 (50%)
Ig strand E 125..131 CDD:409490 2/5 (40%)
Ig strand F 143..151 CDD:409490 5/7 (71%)
Ig strand G 154..166 CDD:409490 4/11 (36%)
IgI_2_Robo 173..258 CDD:409389 17/86 (20%)
Ig strand A 173..176 CDD:409389 0/2 (0%)
Ig strand A' 178..182 CDD:409389 0/3 (0%)
Ig strand B 186..193 CDD:409389 1/6 (17%)
Ig strand C 201..206 CDD:409389 1/4 (25%)
Ig strand C' 208..211 CDD:409389 1/3 (33%)
Ig strand D 217..221 CDD:409389 1/4 (25%)
Ig strand E 223..229 CDD:409389 2/5 (40%)
Ig strand F 236..244 CDD:409389 2/7 (29%)
Ig strand G 247..258 CDD:409389 0/10 (0%)
IgI_3_Robo 265..347 CDD:409390 23/96 (24%)
Ig strand A 265..268 CDD:409390 1/2 (50%)
Ig strand A' 270..274 CDD:409390 2/18 (11%)
Ig strand B 277..286 CDD:409390 2/8 (25%)
Ig strand C 292..297 CDD:409390 1/4 (25%)
Ig strand C' 300..303 CDD:409390 0/2 (0%)
Ig strand D 306..311 CDD:409390 2/4 (50%)
Ig strand E 312..319 CDD:409390 2/6 (33%)
Ig strand F 326..334 CDD:409390 3/7 (43%)
Ig strand G 337..347 CDD:409390 1/9 (11%)
IgI_4_Robo 355..452 CDD:409391 22/97 (23%)
Ig strand A 355..359 CDD:409391 1/3 (33%)
Ig strand A' 361..365 CDD:409391 1/3 (33%)
Ig strand B 371..379 CDD:409391 6/7 (86%)
Ig strand C 382..389 CDD:409391 1/6 (17%)
Ig strand C' 391..394 CDD:409391 0/2 (0%)
Ig strand D 407..412 CDD:409391 0/4 (0%)
Ig strand E 414..421 CDD:409391 3/6 (50%)
Ig strand F 427..436 CDD:409391 2/8 (25%)
FN3 428..882 CDD:442628 114/577 (20%)
Ig strand G 438..449 CDD:409391 2/10 (20%)
IgI_5_Robo 459..545 CDD:409544 25/88 (28%)
Ig strand A 459..462 CDD:409544 0/2 (0%)
Ig strand A' 466..469 CDD:409544 0/2 (0%)
Ig strand B 475..482 CDD:409544 1/6 (17%)
Ig strand C 488..493 CDD:409544 1/4 (25%)
Ig strand C' 495..497 CDD:409544 1/1 (100%)
Ig strand D 504..508 CDD:409544 1/3 (33%)
Ig strand E 511..516 CDD:409544 2/4 (50%)
Ig strand F 524..532 CDD:409544 6/7 (86%)
Ig strand G 535..545 CDD:409544 2/10 (20%)
FN3 564..650 CDD:238020 23/98 (23%)
ContNP_649461.2 CLECT 139..>223 CDD:214480
Ig 361..466 CDD:472250 37/108 (34%)
Ig strand B 384..388 CDD:409356 2/3 (67%)
Ig strand C 397..409 CDD:409356 2/11 (18%)
Ig strand E 428..432 CDD:409356 2/7 (29%)
Ig strand F 443..448 CDD:409356 2/4 (50%)
Ig strand G 457..460 CDD:409356 1/2 (50%)
Ig 474..559 CDD:472250 20/92 (22%)
Ig strand B 485..489 CDD:409392 0/3 (0%)
Ig strand C 499..503 CDD:409392 0/3 (0%)
Ig strand E 523..527 CDD:409392 2/3 (67%)
Ig strand F 537..542 CDD:409392 2/4 (50%)
Ig strand G 553..556 CDD:409392 1/2 (50%)
Ig_3 584..644 CDD:464046 17/59 (29%)
Ig_3 660..738 CDD:464046 19/82 (23%)
Ig 756..844 CDD:472250 25/88 (28%)
Ig strand B 775..779 CDD:409358 0/3 (0%)
Ig strand C 788..792 CDD:409358 0/3 (0%)
Ig strand E 810..814 CDD:409358 2/3 (67%)
Ig strand F 824..829 CDD:409358 3/4 (75%)
Ig strand G 837..840 CDD:409358 0/2 (0%)
Ig <868..944 CDD:472250 0/75 (0%)
Ig strand C 881..885 CDD:409359 0/3 (0%)
Ig strand E 906..910 CDD:409359 0/3 (0%)
Ig strand F 920..925 CDD:409359 0/4 (0%)
Ig strand G 933..936 CDD:409359 0/2 (0%)
FN3 944..1043 CDD:238020 25/103 (24%)
FN3 1053..1146 CDD:238020 20/115 (17%)
fn3 1156..1244 CDD:394996 23/93 (25%)
fn3 1259..1346 CDD:394996 19/109 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.