DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ROBO1 and tei

DIOPT Version :10

Sequence 1:XP_011532278.1 Gene:ROBO1 / 6091 HGNCID:10249 Length:1654 Species:Homo sapiens
Sequence 2:NP_523731.2 Gene:tei / 36521 FlyBaseID:FBgn0000633 Length:822 Species:Drosophila melanogaster


Alignment Length:562 Identity:137/562 - (24%)
Similarity:203/562 - (36%) Gaps:149/562 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    21 HLFLAQLIPDP-------EDVERGNDHGTPIPTSD-------------NDDNSLGYTGSRLRQED 65
            ||....:.|.|       :|||. .|.||  .|||             .|:..|......||...
  Fly   173 HLAPEDMQPKPKEPVIIIDDVEE-FDSGT--STSDLIARKSREEAEEEEDEGPLEPRVLPLRPVP 234

Human    66 FPPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGERVETDKDDPR--SHRMLL-PSGSL 127
            ..|...|..|.:...:.....|.|:.: ....|..|||.|:.|.......|  .:|.:. .:|:|
  Fly   235 PNPYEAEEMSVVYAEQHSEIKLMCEVD-LDIATSMWYKNGQVVHAMDRTARVTDYRFIKEANGAL 298

Human   128 FFLRIVHGRKSRPDEGVYVCVARNYLGEAVSHNA---SLEVA-------ILRDDFRQNPSDVMVA 182
            ....::     ..|:|.:.|.|.|  ....:.||   .|.|.       :|.|..|.:.|::.|.
  Fly   299 TITNVM-----LEDDGKWQCEAEN--TRRYTENARPVKLVVLDRPKPPYLLIDSRRLDASNLFVP 356

Human   183 VGEPAVME--CQPPRGHPEPTISWKKDGSP-LDDKDERIT--------IRGGKL-----MITYTR 231
            |.|.:.:.  |....|:|.||::|:...|| :|...::::        |:|.||     .|....
  Fly   357 VKENSELNLACVSEGGNPRPTLTWEVLLSPGVDRHAQKVSAEVLELEEIKGEKLDKDGYKINSGA 421

Human   232 KSDA-----------GKYVCVGTN-MVGERESEVAELTVLERPSF-VKRPSNLAVTVDDSAE--F 281
            ||:|           .:.:||..: .:..|::....|.|...||| :.|.......:.:..|  .
  Fly   422 KSEARLPAVYRAHHNARILCVMEHPTLKIRQNASLLLDVQYTPSFAISRTPGFGYPLREGIEVSL 486

Human   282 KCEARGDPVPTVRWRKDDGELPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENM------VGKAE 340
            ||:...:|..|.||:||||:.|..:   ..|..|....:.....|.|.|.:.::      :|...
  Fly   487 KCDVDSNPPSTPRWQKDDGDTPVPQ---TGDGFLNFTSIRREHSGWYKCTSRHLNFQYSSIGYYL 548

Human   341 ASATLTVQVGSEPPHFVVKPRDQVVA----------------LGRTVTFQCEATGNPQPAIFWRR 389
            :....:|.|.|||.       ||.|:                ||..||.||     ||       
  Fly   549 SVRFDSVDVTSEPD-------DQDVSVAAASHNPNKGQLEVQLGGAVTLQC-----PQ------- 594

Human   390 EGSQNLLFSYQPPQSSSR---FSVSQ-TGDLTITNVQRSDVGYYICQTLNVAGSIITKAYLEVTD 450
             ||........|..:..|   :..|| ||..::.:|...|.|.|.|    |..|...|..|||..
  Fly   595 -GSLGCWSHLDPISARLRGLGYGSSQPTGQFSLKDVMYQDAGMYKC----VGQSPTNKKKLEVLQ 654

Human   451 VIADRPPPVIRQGPVNQTVAVDGT-FVLSCVAT-----GSPV 486
            .:               ||:|.|. .|::..||     |||:
  Fly   655 SV---------------TVSVKGAPTVMALNATPVAYPGSPL 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ROBO1XP_011532278.1 IgC_1_Robo 68..166 CDD:409490 23/103 (22%)
Ig strand A 68..72 CDD:409490 1/3 (33%)
Ig strand A' 75..80 CDD:409490 1/4 (25%)
Ig strand B 84..92 CDD:409490 2/7 (29%)
Ig strand C 98..103 CDD:409490 2/4 (50%)
Ig strand C' 106..108 CDD:409490 0/1 (0%)
Ig strand D 119..122 CDD:409490 1/2 (50%)
Ig strand E 125..131 CDD:409490 2/5 (40%)
Ig strand F 143..151 CDD:409490 3/7 (43%)
Ig strand G 154..166 CDD:409490 3/14 (21%)
IgI_2_Robo 173..258 CDD:409389 26/112 (23%)
Ig strand A 173..176 CDD:409389 1/2 (50%)
Ig strand A' 178..182 CDD:409389 0/3 (0%)
Ig strand B 186..193 CDD:409389 1/8 (13%)
Ig strand C 201..206 CDD:409389 2/4 (50%)
Ig strand C' 208..211 CDD:409389 2/3 (67%)
Ig strand D 217..221 CDD:409389 0/11 (0%)
Ig strand E 223..229 CDD:409389 3/10 (30%)
Ig strand F 236..244 CDD:409389 2/7 (29%)
Ig strand G 247..258 CDD:409389 2/10 (20%)
IgI_3_Robo 265..347 CDD:409390 19/89 (21%)
Ig strand A 265..268 CDD:409390 0/2 (0%)
Ig strand A' 270..274 CDD:409390 0/3 (0%)
Ig strand B 277..286 CDD:409390 3/10 (30%)
Ig strand C 292..297 CDD:409390 3/4 (75%)
Ig strand C' 300..303 CDD:409390 1/2 (50%)
Ig strand D 306..311 CDD:409390 0/4 (0%)
Ig strand E 312..319 CDD:409390 2/6 (33%)
Ig strand F 326..334 CDD:409390 3/7 (43%)
Ig strand G 337..347 CDD:409390 1/9 (11%)
IgI_4_Robo 355..452 CDD:409391 30/116 (26%)
Ig strand A 355..359 CDD:409391 0/3 (0%)
Ig strand A' 361..365 CDD:409391 2/3 (67%)
Ig strand B 371..379 CDD:409391 4/7 (57%)
Ig strand C 382..389 CDD:409391 1/6 (17%)
Ig strand C' 391..394 CDD:409391 2/2 (100%)
Ig strand D 407..412 CDD:409391 1/7 (14%)
Ig strand E 414..421 CDD:409391 1/6 (17%)
Ig strand F 427..436 CDD:409391 3/8 (38%)
FN3 428..882 CDD:442628 18/65 (28%)
Ig strand G 438..449 CDD:409391 4/10 (40%)
IgI_5_Robo 459..545 CDD:409544 10/34 (29%)
Ig strand A 459..462 CDD:409544 0/2 (0%)
Ig strand A' 466..469 CDD:409544 0/2 (0%)
Ig strand B 475..482 CDD:409544 1/6 (17%)
Ig strand C 488..493 CDD:409544
Ig strand C' 495..497 CDD:409544
Ig strand D 504..508 CDD:409544
Ig strand E 511..516 CDD:409544
Ig strand F 524..532 CDD:409544
Ig strand G 535..545 CDD:409544
FN3 564..650 CDD:238020
teiNP_523731.2 IG_like 244..332 CDD:214653 21/95 (22%)
Ig strand B 254..258 CDD:409353 1/3 (33%)
Ig strand C 267..271 CDD:409353 1/3 (33%)
Ig strand E 296..300 CDD:409353 2/3 (67%)
Ig strand F 310..315 CDD:409353 1/4 (25%)
Ig strand G 326..329 CDD:409353 0/2 (0%)
Ig 359..452 CDD:472250 20/92 (22%)
Ig_3 478..533 CDD:464046 16/57 (28%)
IG_like 578..660 CDD:214653 29/113 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.