DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ROBO1 and Dscam1

DIOPT Version :10

Sequence 1:XP_011532278.1 Gene:ROBO1 / 6091 HGNCID:10249 Length:1654 Species:Homo sapiens
Sequence 2:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster


Alignment Length:1862 Identity:405/1862 - (21%)
Similarity:647/1862 - (34%) Gaps:502/1862 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    25 AQLIPDPEDVERGND-------HGTPIPTSD--NDDNSLGYTGSRLRQEDF-------------- 66
            |::.|..:.|:.|..       .|.||.|..  .|..::|::...||.|..              
  Fly   349 AKIDPPTQTVDFGRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRN 413

Human    67 ------------------PPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGERVETDKD 113
                              ||.|.:...:..:..|....|.|.|.|.|||.|.|...|::: .:.|
  Fly   414 DQESAEASAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKI-ANND 477

Human   114 DPRSHRMLLPSGSLF-FLRI--VHGRKSRPDEGVYVCVARNYLGEAVSHNASLEVAILRDDFRQN 175
            ..:..:.:..:|.:. :|.|  ||..    |.|:|.|:|::.:|.| .|:|.|.|..| ...||.
  Fly   478 RYQVGQYVTVNGDVVSYLNITSVHAN----DGGLYKCIAKSKVGVA-EHSAKLNVYGL-PYIRQM 536

Human   176 PSDVMVAVGEPAVMECQPPRGHPEPTISWKKDGSPLD-DKDERITIRGGKLMITYTRKSDAGKYV 239
            ....:|| ||..::.| |..|:|..:|.|::|...|. ::.:::...|..::....|.||...|.
  Fly   537 EKKAIVA-GETLIVTC-PVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYT 599

Human   240 CVGTNMVGERESEVAELTVLERPSFVKRPSNLAVTVDDSAEFKCE-ARGDPVPTVRWRKD----- 298
            ||..|..|.......|:.|:..|..|.......:.:.||.:..|: .:||....|.|..:     
  Fly   600 CVAKNQEGYSARGSLEVQVMVLPQIVPFAYEDLINMGDSIDLFCQIQKGDRPIKVHWSFERSAGD 664

Human   299 ---DGELPKSRYEIRDDHT--LKIRKVTAGDMGSYTCVAENMVGKAEASATLTVQVGSEPPHFVV 358
               |...|:.|.....:.|  :.|...:....|..||:|.|..|....|..|||.|   ||.:::
  Fly   665 YGFDQVQPQMRTNRISEKTSMISIPSASPAHTGRDTCIASNKAGTTTYSVDLTVNV---PPRWIL 726

Human   359 KPRDQVVALGRTVTFQCEATGNPQPAIFWRR-----EGSQNLLFSYQPPQSSSRFSVSQTGDLTI 418
            :|.|:..|.|.....:|:|.|.|:|.:.|::     .|      .|:..:.|....|.: |.|.:
  Fly   727 EPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPG------EYKDLKKSDNIRVEE-GTLHV 784

Human   419 TNVQRSDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPVIRQGPVNQTVAVDGTFVLSCVATG 483
            .|:|:::.|||:|:.:|..||     .|....:|:.:.||...:...|||.......||.|.|.|
  Fly   785 DNIQKTNEGYYLCEAINGIGS-----GLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKG 844

Human   484 SPVPTILWRKDGVLVSTQDS-----RIKQLENGV---LQIRYAKLGDTGRYTCIASTPSGEATWS 540
            .....|||..:.:.:..::.     |.:.|..||   |.|:..:..|:..:||:|:...|....|
  Fly   845 EKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDAS 909

Human   541 AYIEVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGATPTSYIIEAFSHA 605
            ..:.|||               :|..|...:|.|.|..:|.|||....:..:....|||| |.. 
  Fly   910 INMIVQE---------------VPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIE-FKR- 957

Human   606 SGSSWQTVAENV---KTETSAIKGLKPNAIYLFLVRAANAYGISDPSQISDPVKTQDVLPTSQGV 667
            |.:||..:...:   .|..:.::.|.|...|...:.|.||.|.|..|: :..:.|.:..|:.:..
  Fly   958 SRASWSEIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSE-AVTIITAEEAPSGKPQ 1021

Human   668 DHKQVQRELGNAVLHLHNPTVLSSSSIEVHWTVDQQSQY---IQGYKILYRPSGANHGESDWLVF 729
            :.|.             .|  ::.:::.|.|....::::   |.||.:.|:.|..|..    .||
  Fly  1022 NIKV-------------EP--VNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSS----YVF 1067

Human   730 E-----VRTPAKNSVVIPDLRKGVNYEIKARPFFNEFQGADSEIKFAKTLEEAPSAPPQGVTVSK 789
            |     .....::::.:.:||....|.:..:.|.....|..||.:...|.|..||.||.....:.
  Fly  1068 ETINFITEEGKEHNLELQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTT 1132

Human   790 NDGNGTAILVSWQPPPEDTQNGMVQEYKV-------WCLGNETRYHINKTVDGSTFSVVIPFLVP 847
            .  ....|.|.|..||.::.||:::.|||       |.  :||:.|..||....|   |:..|..
  Fly  1133 L--TSQTIRVGWVSPPLESANGVIKTYKVVYAPSDEWY--DETKRHYKKTASSDT---VLHGLKK 1190

Human   848 GIRYSVEVAASTGAGSGVKSEPQFIQLDAHGNPVSPEDQVSLAQQISDVV---KQPAFIAGIGAA 909
            ...|:::|.|:|..|.||:|.|...|.:. ..|.:|.|..:|....:.::   :.||...||   
  Fly  1191 YTNYTMQVLATTAGGDGVRSVPIHCQTEP-DVPEAPTDVKALVMGNAAILVSWRPPAQPNGI--- 1251

Human   910 CWIILMVFSIWLYRHRKKRNGLTSTYAGIRKVP-----------------SFTFTPTVTYQRGGE 957
                     |..|....|..| ..|....:|||                 .|..|.:.|...|.:
  Fly  1252 ---------ITQYTVYSKAEG-AETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQ 1306

Human   958 AVSSGGRPG--------------LLNISEPAAQPWLA-------DTWPNTG-------------- 987
            :.|....|.              .....|.|..|.||       .||...|              
  Fly  1307 SKSIVAMPSDQVPAKIASFDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLPD 1371

Human   988 -------NNHNDCSISCCTAGNGNSDSNLTTYSRPADCIANYNNQLDNKQTNLMLPESTVYGDVD 1045
                   .|..|.....|.|.|..:..::|                 :|...|..|:|.   .|.
  Fly  1372 GSLLIKSVNRQDAGDYSCHAENSIAKDSIT-----------------HKLIVLAPPQSP---HVT 1416

Human  1046 LSNKINEMKTFN-SPNLKD-----GRFVNPSGQPTPYATTQLIQSNLSNNM-------------- 1090
            ||....:..|.. .|:..|     |..::...:...:.|:::...:..:|:              
  Fly  1417 LSATTTDALTVKLKPHEGDTAPLHGYTLHYKPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYAT 1481

Human  1091 ---NNGSGDSGE-------------------------------KHWK----PLGQ---QKQEVAP 1114
               |.|:|::.:                               |.||    |:..   :.::...
  Fly  1482 GFNNIGAGEASDILNTRTKGQKPKLPEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQ 1546

Human  1115 VQYNIVEQN-KLNKDYRANDTVPPTIPYN-------------QSYD----QNTGGSYNSSDRGSS 1161
            :::|.:..| |.:.:|...|..|.|. ||             ..||    ..|||:....|.|| 
  Fly  1547 IEWNQISNNVKPDNNYVVLDLEPATW-YNLRITAHNSAGFTVAEYDFATLTVTGGTIAPLDDGS- 1609

Human  1162 TSGSQGH---KKGARTPK-VPKQGGMNWADL--LPPPPA------------------HPPPHSNS 1202
                 ||   ....|.|. :|:     |.||  :.|..|                  ........
  Fly  1610 -----GHGNVHTRIRLPAWMPE-----WLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRG 1664

Human  1203 EEYNISVDESYDQEMPCPVPPARMYLQQDELEEEEDERGP----TPPVRGAASSPAAVSY----- 1258
            .:.::..|..|:|.|.   |.|.:..::.:|.:|.....|    .|||.|:       :|     
  Fly  1665 GQKDVYYDVVYNQTMG---PGATLDKRRPDLRDELGYIAPPNRKLPPVPGS-------NYNTCDR 1719

Human  1259 ---------SHQST--ATLTPSPQEELQ------------------------PMLQD--CPEETG 1286
                     |:.||  ....|:..|||:                        |.::|  ||..|.
  Fly  1720 IKRGRGGLRSNHSTWDPRRNPNLYEELKAPPVPMHGNHYGHAHGNAECHYRHPGMEDEICPYATF 1784

Human  1287 HMQHQPDRRRQPVSPPPPPRPISPPHTYGYISGPLVSDMDTDAP-------EEEEDEADMEVAKM 1344
            |:.    ..|:.:.|.......:.||..|: :||:.....|..|       ........|..|..
  Fly  1785 HLL----GFREEMDPTKAMNFQTFPHQNGH-AGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANR 1844

Human  1345 QTRRLLLRGLEQ--TPASSVGDLESSVTGSMINGWGSASEEDNISSGRSSVSSSDGSFFT--DAD 1405
            ..|:....|...  |||....|.            .:.:|||.... .:.|:|..||.::  ..:
  Fly  1845 YQRKNSQGGQSSIYTPAPEYDDP------------ANCAEEDQYRR-YTRVNSQGGSLYSGPGPE 1896

Human  1406 FAQAVAAAAEYAGLKVARRQMQDAAGRRHFHASQCPRPTSPVSTDSNMSAAVMQKTRPAKKLKHQ 1470
            :......|.|           :|..|.:  :.....:|.....:..:|....:...|       .
  Fly  1897 YDDPANCAPE-----------EDQYGSQ--YGGPYGQPYDHYGSRGSMGRRSIGSAR-------N 1941

Human  1471 PGHLRRETYTDDLPPPPVPPP----AIKSPTAQSKTQLEVRPVVVPKLPSMDARTDRSSDRKGSS 1531
            ||        :..|.||.|||    ...|....||...|:          .:|..||....:| :
  Fly  1942 PG--------NGSPEPPPPPPRNHDMSNSSFNDSKESNEI----------SEAECDRDHGPRG-N 1987

Human  1532 Y----KGREVLDGRQVVDMR----TNPGDPREAQEQQNDGKG 1565
            |    :..:..|.|...:||    .|...|::.|.||.:|.|
  Fly  1988 YGAVKRSPQPKDQRTTEEMRKLIERNETGPKQLQLQQANGAG 2029

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ROBO1XP_011532278.1 IgC_1_Robo 68..166 CDD:409490 29/100 (29%)
Ig strand A 68..72 CDD:409490 2/3 (67%)
Ig strand A' 75..80 CDD:409490 0/4 (0%)
Ig strand B 84..92 CDD:409490 2/7 (29%)
Ig strand C 98..103 CDD:409490 2/4 (50%)
Ig strand C' 106..108 CDD:409490 0/1 (0%)
Ig strand D 119..122 CDD:409490 0/2 (0%)
Ig strand E 125..131 CDD:409490 1/6 (17%)
Ig strand F 143..151 CDD:409490 4/7 (57%)
Ig strand G 154..166 CDD:409490 5/11 (45%)
IgI_2_Robo 173..258 CDD:409389 24/85 (28%)
Ig strand A 173..176 CDD:409389 2/2 (100%)
Ig strand A' 178..182 CDD:409389 0/3 (0%)
Ig strand B 186..193 CDD:409389 1/6 (17%)
Ig strand C 201..206 CDD:409389 2/4 (50%)
Ig strand C' 208..211 CDD:409389 0/2 (0%)
Ig strand D 217..221 CDD:409389 0/3 (0%)
Ig strand E 223..229 CDD:409389 0/5 (0%)
Ig strand F 236..244 CDD:409389 3/7 (43%)
Ig strand G 247..258 CDD:409389 2/10 (20%)
IgI_3_Robo 265..347 CDD:409390 21/92 (23%)
Ig strand A 265..268 CDD:409390 1/2 (50%)
Ig strand A' 270..274 CDD:409390 0/3 (0%)
Ig strand B 277..286 CDD:409390 3/9 (33%)
Ig strand C 292..297 CDD:409390 2/4 (50%)
Ig strand C' 300..303 CDD:409390 0/2 (0%)
Ig strand D 306..311 CDD:409390 1/4 (25%)
Ig strand E 312..319 CDD:409390 2/8 (25%)
Ig strand F 326..334 CDD:409390 4/7 (57%)
Ig strand G 337..347 CDD:409390 3/9 (33%)
IgI_4_Robo 355..452 CDD:409391 26/101 (26%)
Ig strand A 355..359 CDD:409391 0/3 (0%)
Ig strand A' 361..365 CDD:409391 1/3 (33%)
Ig strand B 371..379 CDD:409391 2/7 (29%)
Ig strand C 382..389 CDD:409391 2/6 (33%)
Ig strand C' 391..394 CDD:409391 1/2 (50%)
Ig strand D 407..412 CDD:409391 1/4 (25%)
Ig strand E 414..421 CDD:409391 2/6 (33%)
Ig strand F 427..436 CDD:409391 4/8 (50%)
FN3 428..882 CDD:442628 121/479 (25%)
Ig strand G 438..449 CDD:409391 3/10 (30%)
IgI_5_Robo 459..545 CDD:409544 23/93 (25%)
Ig strand A 459..462 CDD:409544 0/2 (0%)
Ig strand A' 466..469 CDD:409544 2/2 (100%)
Ig strand B 475..482 CDD:409544 3/6 (50%)
Ig strand C 488..493 CDD:409544 3/4 (75%)
Ig strand C' 495..497 CDD:409544 0/1 (0%)
Ig strand D 504..508 CDD:409544 1/3 (33%)
Ig strand E 511..516 CDD:409544 3/7 (43%)
Ig strand F 524..532 CDD:409544 3/7 (43%)
Ig strand G 535..545 CDD:409544 2/9 (22%)
FN3 564..650 CDD:238020 26/88 (30%)
Dscam1NP_001246162.1 IgI_1_Dscam 38..136 CDD:409547
Ig strand A 39..42 CDD:409547
Ig strand A' 48..52 CDD:409547
Ig strand B 55..64 CDD:409547
Ig strand C 70..76 CDD:409547
Ig strand C' 78..81 CDD:409547
Ig strand D 87..90 CDD:409547
Ig strand E 95..100 CDD:409547
Ig strand F 113..121 CDD:409547
Ig strand G 124..136 CDD:409547
IgI_2_Dscam 246..343 CDD:409545
Ig strand A 247..250 CDD:409545
Ig strand A' 260..264 CDD:409545
Ig strand B 267..274 CDD:409545
Ig strand C 282..288 CDD:409545
Ig strand C' 294..297 CDD:409545
Ig strand D 303..307 CDD:409545
Ig strand E 309..315 CDD:409545
Ig strand F 322..330 CDD:409545
Ig strand G 333..343 CDD:409545
IgC2_3_Dscam 346..426 CDD:409549 13/76 (17%)
Ig strand A 347..352 CDD:409549 1/2 (50%)
Ig strand A' 355..359 CDD:409549 0/3 (0%)
Ig strand B 362..372 CDD:409549 0/9 (0%)
Ig strand C 377..383 CDD:409549 1/5 (20%)
Ig strand C' 384..387 CDD:409549 0/2 (0%)
Ig strand E 392..398 CDD:409549 2/5 (40%)
Ig strand F 405..413 CDD:409549 0/7 (0%)
Ig strand G 416..426 CDD:409549 0/9 (0%)
IgI_4_Dscam 432..527 CDD:409548 30/100 (30%)
Ig strand A 432..435 CDD:409548 2/2 (100%)
Ig strand A' 441..445 CDD:409548 0/3 (0%)
Ig strand B 448..457 CDD:409548 2/8 (25%)
Ig strand C 462..468 CDD:409548 3/5 (60%)
Ig strand C' 470..473 CDD:409548 1/2 (50%)
Ig strand D 478..486 CDD:409548 0/7 (0%)
Ig strand E 490..499 CDD:409548 2/8 (25%)
Ig strand F 506..514 CDD:409548 4/7 (57%)
Ig strand G 517..527 CDD:409548 5/10 (50%)
IgI_5_Dscam 531..618 CDD:409550 24/88 (27%)
Ig strand A 531..533 CDD:409550 0/1 (0%)
Ig strand A' 538..542 CDD:409550 0/3 (0%)
Ig strand B 545..552 CDD:409550 2/7 (29%)
Ig strand C 559..565 CDD:409550 2/5 (40%)
Ig strand C' 566..568 CDD:409550 1/1 (100%)
Ig strand D 575..579 CDD:409550 0/3 (0%)
Ig strand E 582..588 CDD:409550 1/5 (20%)
Ig strand F 596..604 CDD:409550 3/7 (43%)
Ig strand G 608..618 CDD:409550 1/9 (11%)
Ig 621..718 CDD:472250 22/96 (23%)
Ig strand B 639..643 CDD:409353 0/3 (0%)
Ig strand C 653..657 CDD:409353 1/3 (33%)
Ig strand E 684..688 CDD:409353 0/3 (0%)
Ig strand F 698..703 CDD:409353 2/4 (50%)
Ig strand G 711..714 CDD:409353 0/2 (0%)
IgI_7_Dscam 721..815 CDD:409546 29/105 (28%)
Ig strand A 721..725 CDD:409546 2/3 (67%)
Ig strand A' 730..734 CDD:409546 1/3 (33%)
Ig strand B 737..746 CDD:409546 1/8 (13%)
Ig strand C 752..758 CDD:409546 1/5 (20%)
Ig strand C' 764..767 CDD:409546 1/8 (13%)
Ig strand D 775..778 CDD:409546 0/2 (0%)
Ig strand E 780..786 CDD:409546 2/5 (40%)
Ig strand F 793..801 CDD:409546 4/7 (57%)
Ig strand G 806..815 CDD:409546 2/8 (25%)
Ig 818..916 CDD:472250 26/97 (27%)
Ig strand B 836..840 CDD:409353 2/3 (67%)
Ig strand C 849..853 CDD:409353 2/3 (67%)
Ig strand E 880..884 CDD:409353 1/3 (33%)
Ig strand F 894..899 CDD:409353 2/4 (50%)
FN3 <899..1212 CDD:442628 88/356 (25%)
Ig strand G 907..910 CDD:409353 0/2 (0%)
FN3 1222..1312 CDD:238020 21/102 (21%)
Ig <1339..1406 CDD:472250 13/83 (16%)
Ig strand C 1350..1354 CDD:409358 1/3 (33%)
Ig strand E 1372..1376 CDD:409358 0/3 (0%)
Ig strand F 1386..1391 CDD:409358 1/4 (25%)
Ig strand G 1399..1402 CDD:409358 1/19 (5%)
FN3 1409..1499 CDD:238020 14/92 (15%)
FN3 1504..1584 CDD:238020 13/80 (16%)
Dscam_C 1893..2008 CDD:463546 27/153 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.