DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ROBO1 and Nrg

DIOPT Version :10

Sequence 1:XP_011532278.1 Gene:ROBO1 / 6091 HGNCID:10249 Length:1654 Species:Homo sapiens
Sequence 2:NP_001245581.1 Gene:Nrg / 31792 FlyBaseID:FBgn0264975 Length:1309 Species:Drosophila melanogaster


Alignment Length:1513 Identity:330/1513 - (21%)
Similarity:504/1513 - (33%) Gaps:469/1513 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    58 GSRLRQEDFPPRIVEHPS--DLIVSKGE-------PATLNCKAEGRPTPTIEWYKGGERVETDKD 113
            ||...:.:.||||.:.|:  :|:....:       |..:.|:|:|:|.|...|.|.|::.:....
  Fly    19 GSAESKGNRPPRITKQPAPGELLFKVAQQNKESDNPFIIECEADGQPEPEYSWIKNGKKFDWQAY 83

Human   114 DPRSHRMLLPSGSLFFLRIVHGRKSRPDEGVYVCVARNYLGEAVSHNASLEVAILRDDFRQNPSD 178
            |.|..|.  |......:.|    ....|.|.|.|.|.|..|.|.|::..:..|.| :.|:...:.
  Fly    84 DNRMLRQ--PGRGTLVITI----PKDEDRGHYQCFASNEFGTATSNSVYVRKAEL-NAFKDEAAK 141

Human   179 VMVAV-GEPAVMECQPPRGHPEPTISW--------------------------------KKD--- 207
            .:.|| |||.:::|..|.|.|.||::|                                ::|   
  Fly   142 TLEAVEGEPFMLKCAAPDGFPSPTVNWMIQESIDGSIKSINNSRMTLDPEGNLWFSNVTREDASS 206

Human   208 ----------------------------------------------------------------- 207
                                                                             
  Fly   207 DFYYACSATSVFRSEYKIGNKVLLDVKQMGVSASQNKHPPVRQYVSRRQSLALRGKRMELFCIYG 271

Human   208 GSPLD----DKD-------ERIT--IRGGKLMITYTRKSDAGKYVCVGTNMVGERESEVAELTVL 259
            |:||.    .||       :|||  ..|..|:|..|...|||.|.|..:|.||..:|....|.|.
  Fly   272 GTPLPQTVWSKDGQRIQWSDRITQGHYGKSLVIRQTNFDDAGTYTCDVSNGVGNAQSFSIILNVN 336

Human   260 ERPSFVKRPSNLAVTVDDSAEFKCEARGDPVPTVRW----RKDDGELPKSRYEIRDDHTLKIRKV 320
            ..|.|.|.|.......|:...|:|.|.|.|.|.:.|    :..:...|..|..: .|:|::|..:
  Fly   337 SVPYFTKEPEIATAAEDEEVVFECRAAGVPEPKISWIHNGKPIEQSTPNPRRTV-TDNTIRIINL 400

Human   321 TAGDMGSYTCVAENMVGKAEASATLTVQVGSEPPHFVVKPRDQVVALGRTVTFQCEATGNPQPAI 385
            ..||.|:|.|.|.|.:|.......|.||  :|||.....|.......||.||.:|...|:|:|.:
  Fly   401 VKGDTGNYGCNATNSLGYVYKDVYLNVQ--AEPPTISEAPAAVSTVDGRNVTIKCRVNGSPKPLV 463

Human   386 FWRREGSQNLLFSYQPPQSSSRFSVSQTGDLTITNVQRSDVGYYICQTLN------VAGSIITKA 444
            .|.|  :.|.|       :..|::|...|||.|.:|..||.|.|.|...|      ..||::.|.
  Fly   464 KWLR--ASNWL-------TGGRYNVQANGDLEIQDVTFSDAGKYTCYAQNKFGEIQADGSLVVKE 519

Human   445 YLEVTDVIADRPPPVIRQGPVNQTVAVDGTFVLSCVATGSPVPTIL--WRKDGVLV--STQDSRI 505
            :..:|            |.|.|..||...:....|.........|.  |.|||..:  ..|...:
  Fly   520 HTRIT------------QEPQNYEVAAGQSATFRCNEAHDDTLEIEIDWWKDGQSIDFEAQPRFV 572

Human   506 KQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYIEVQEFGVPVQPPRPTDPNLIPSAPSKP 570
            |..:|.:...:..:| |:|.|||:|.|...|||..|.:.||:               :|:||...
  Fly   573 KTNDNSLTIAKTMEL-DSGEYTCVARTRLDEATARANLIVQD---------------VPNAPKLT 621

Human   571 EVTDVSRNTVTLSWQPNLNSGATPTSYIIEAFSHASGSSWQTVAENV-KTETSAIKGLKPNAIYL 634
            .:| ...:...:.|:...::.:....|.|:..:..:.:||....|.| .|::|.:..:.|.|.|.
  Fly   622 GIT-CQADKAEIHWEQQGDNRSPILHYTIQFNTSFTPASWDAAYEKVPNTDSSFVVQMSPWANYT 685

Human   635 FLVRAANAYGISDPSQISDPVKTQDVLPTSQGVDHKQVQRELGNAVLHLHNPTVLSSSSIEVHWT 699
            |.|.|.|..|.|.||..||...||..:|      .|.....:|...         ..:::.:.||
  Fly   686 FRVIAFNKIGASPPSAHSDSCTTQPDVP------FKNPDNVVGQGT---------EPNNLVISWT 735

Human   700 ----VDQQSQYIQGYKILYR--PSGA--NHGESDWLVFEVRTPAKNSVVIPDLRKGVNYEIKARP 756
                ::..:.....|....|  |:.|  |:...||        .:|::||.|....|.|.||...
  Fly   736 PMPEIEHNAPNFHYYVSWKRDIPAAAWENNNIFDW--------RQNNIVIADQPTFVKYLIKVVA 792

Human   757 FFNEFQ---GADSEIKFAKTLEEAPSAPPQGVTVSKNDGNGTAILVSWQPPPEDTQNGMVQEYKV 818
            ..:..:   .|:..:.::.  |:.|...|...|: :...:.|:..::|.|..|::..|..:.||:
  Fly   793 INDRGESNVAAEEVVGYSG--EDRPLDAPTNFTM-RQITSSTSGYMAWTPVSEESVRGHFKGYKI 854

Human   819 --WC--LGNETRYHINKTVDGSTFSVVIPFLVPGIRYSVEVAASTGAGSGVKSEPQFIQLDAHGN 879
              |.  .|.|....|:  |.|.|.:.::....|..:....:.|..|..:|..|  ..|..|    
  Fly   855 QTWTENEGEEGLREIH--VKGDTHNALVTQFKPDSKNYARILAYNGRFNGPPS--AVIDFD---- 911

Human   880 PVSPEDQVSLAQQISDVVKQPAFIAGIGAACWIILMVFSIWLYRHRKK---RNG----------- 930
              :||...|..|.:.      |:  .:|::.:::          |.||   .||           
  Fly   912 --TPEGVPSPVQGLD------AY--PLGSSAFML----------HWKKPLYPNGKLTGYKIYYEE 956

Human   931 LTSTYAGIRKVPSFTFTPTVTYQRGGEAVSSGGRPGLLNISEPAAQPWLADTWPNTGNNHNDCSI 995
            :..:|.|.|:    .:.|.:|..|......:|.:|                      |:....||
  Fly   957 VKESYVGERR----EYDPHITDPRVTRMKMAGLKP----------------------NSKYRISI 995

Human   996 SCCT-AGNGNSDSNLTTYSRPADCIANYNNQLDNKQTNLMLPESTVYGDVDLSN-KINEMKTFNS 1058
            :..| .|.|:......|..:.|..:|........:|    ||     .|..|:. :||.:     
  Fly   996 TATTKMGEGSEHYIEKTTLKDAVNVAPATPSFSWEQ----LP-----SDNGLAKFRINWL----- 1046

Human  1059 PNLKDGRFVNPS--GQP-TPYATTQLIQSNLSNNMNNGSGDSGEKHWKPLGQQKQEVAPVQYNIV 1120
                      ||  |.| |.:.|...|:              ||..|                |.
  Fly  1047 ----------PSTEGHPGTHFFTMHRIK--------------GETQW----------------IR 1071

Human  1121 EQNKLNKDYRANDTVPPTIPY----------------NQSYDQNT-------------------- 1149
            |..:.|.||:....:.|...|                .|..|.||                    
  Fly  1072 ENEEKNSDYQEVGGLDPETAYEFRVVSVDGHFNTESATQEIDTNTVEGPIMVANETVANAGWFIG 1136

Human  1150 ----------------------GGSYNSSDRGSSTSGSQGHKKGARTPKVPKQGGMNWADLLPPP 1192
                                  ||.|:..|| ...:|.:.:         |::||.:        
  Fly  1137 MMLALAFIIILFIIICIIRRNRGGKYDVHDR-ELANGRRDY---------PEEGGFH-------- 1183

Human  1193 PAHPPPHSNSEEYNISVD-ESYDQEMPCPVPPARMYLQQDELEEEEDERGPTPPVRGAASSPAAV 1256
                       ||:..:| :|..::.........:....|.:.|..|  |.|.....||.:.||.
  Fly  1184 -----------EYSQPLDNKSAGRQSVSSANKPGVESDTDSMAEYGD--GDTAVATAAARAAAAA 1235

Human  1257 SYSHQSTATLTPSPQEELQPMLQDCPEETGHMQHQPDRRRQPVSP-----PPPPRPISPPHTYGY 1316
            .....|..|.|...|::.|...|        .|.||........|     .|.|.|.|       
  Fly  1236 RSKLTSLPTSTQQQQQQQQQQQQ--------QQEQPQSTSASTVPLISLASPSPSPSS------- 1285

Human  1317 ISGPLVSDMDTDAPEEEE 1334
                 .|:..|.||...|
  Fly  1286 -----TSNSPTAAPPSYE 1298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ROBO1XP_011532278.1 IgC_1_Robo 68..166 CDD:409490 28/106 (26%)
Ig strand A 68..72 CDD:409490 3/3 (100%)
Ig strand A' 75..80 CDD:409490 1/6 (17%)
Ig strand B 84..92 CDD:409490 2/7 (29%)
Ig strand C 98..103 CDD:409490 1/4 (25%)
Ig strand C' 106..108 CDD:409490 0/1 (0%)
Ig strand D 119..122 CDD:409490 1/2 (50%)
Ig strand E 125..131 CDD:409490 0/5 (0%)
Ig strand F 143..151 CDD:409490 4/7 (57%)
Ig strand G 154..166 CDD:409490 3/11 (27%)
IgI_2_Robo 173..258 CDD:409389 35/198 (18%)
Ig strand A 173..176 CDD:409389 0/2 (0%)
Ig strand A' 178..182 CDD:409389 0/3 (0%)
Ig strand B 186..193 CDD:409389 2/6 (33%)
Ig strand C 201..206 CDD:409389 2/36 (6%)
Ig strand C' 208..211 CDD:409389 1/2 (50%)
Ig strand D 217..221 CDD:409389 3/5 (60%)
Ig strand E 223..229 CDD:409389 2/5 (40%)
Ig strand F 236..244 CDD:409389 3/7 (43%)
Ig strand G 247..258 CDD:409389 3/10 (30%)
IgI_3_Robo 265..347 CDD:409390 24/85 (28%)
Ig strand A 265..268 CDD:409390 1/2 (50%)
Ig strand A' 270..274 CDD:409390 0/3 (0%)
Ig strand B 277..286 CDD:409390 2/8 (25%)
Ig strand C 292..297 CDD:409390 1/8 (13%)
Ig strand C' 300..303 CDD:409390 0/2 (0%)
Ig strand D 306..311 CDD:409390 1/4 (25%)
Ig strand E 312..319 CDD:409390 3/6 (50%)
Ig strand F 326..334 CDD:409390 4/7 (57%)
Ig strand G 337..347 CDD:409390 2/9 (22%)
IgI_4_Robo 355..452 CDD:409391 30/102 (29%)
Ig strand A 355..359 CDD:409391 0/3 (0%)
Ig strand A' 361..365 CDD:409391 0/3 (0%)
Ig strand B 371..379 CDD:409391 3/7 (43%)
Ig strand C 382..389 CDD:409391 2/6 (33%)
Ig strand C' 391..394 CDD:409391 0/2 (0%)
Ig strand D 407..412 CDD:409391 2/4 (50%)
Ig strand E 414..421 CDD:409391 4/6 (67%)
Ig strand F 427..436 CDD:409391 4/14 (29%)
FN3 428..882 CDD:442628 109/479 (23%)
Ig strand G 438..449 CDD:409391 3/10 (30%)
IgI_5_Robo 459..545 CDD:409544 26/89 (29%)
Ig strand A 459..462 CDD:409544 0/2 (0%)
Ig strand A' 466..469 CDD:409544 1/2 (50%)
Ig strand B 475..482 CDD:409544 1/6 (17%)
Ig strand C 488..493 CDD:409544 2/6 (33%)
Ig strand C' 495..497 CDD:409544 1/1 (100%)
Ig strand D 504..508 CDD:409544 1/3 (33%)
Ig strand E 511..516 CDD:409544 0/4 (0%)
Ig strand F 524..532 CDD:409544 5/7 (71%)
Ig strand G 535..545 CDD:409544 4/9 (44%)
FN3 564..650 CDD:238020 23/86 (27%)
NrgNP_001245581.1 Ig 29..128 CDD:472250 28/104 (27%)
Ig strand B 55..59 CDD:409353 0/3 (0%)
Ig strand C 68..72 CDD:409353 0/3 (0%)
Ig strand E 94..98 CDD:409353 0/3 (0%)
Ig strand F 108..113 CDD:409353 2/4 (50%)
Ig strand G 122..125 CDD:409353 1/2 (50%)
Ig 137..216 CDD:472250 13/78 (17%)
Ig strand B 151..155 CDD:409353 0/3 (0%)
Ig strand C 165..169 CDD:409353 1/3 (33%)
Ig strand E 192..196 CDD:409353 0/3 (0%)
Ig strand F 209..214 CDD:409353 0/4 (0%)
ig 251..332 CDD:395002 21/80 (26%)
Ig strand B 264..268 CDD:409353 0/3 (0%)
Ig strand C 277..281 CDD:409353 0/3 (0%)
Ig strand E 305..309 CDD:409353 1/3 (33%)
Ig strand F 314..319 CDD:409353 2/4 (50%)
Ig strand G 328..331 CDD:409353 1/2 (50%)
IgI_4_hemolin-like 339..427 CDD:409570 26/88 (30%)
Ig strand A 339..342 CDD:409570 1/2 (50%)
Ig strand A' 348..351 CDD:409570 0/2 (0%)
Ig strand B 356..363 CDD:409570 2/6 (33%)
Ig strand C 369..374 CDD:409570 1/4 (25%)
Ig strand C' 377..379 CDD:409570 0/1 (0%)
Ig strand D 387..391 CDD:409570 1/4 (25%)
Ig strand E 393..397 CDD:409570 1/3 (33%)
Ig strand F 406..414 CDD:409570 4/7 (57%)
Ig strand G 417..427 CDD:409570 2/9 (22%)
Ig 446..517 CDD:472250 27/79 (34%)
Ig strand B 449..453 CDD:409358 2/3 (67%)
Ig strand C 462..466 CDD:409358 0/3 (0%)
Ig strand E 483..487 CDD:409358 3/3 (100%)
Ig strand F 497..502 CDD:409358 2/4 (50%)
Ig strand G 510..513 CDD:409358 0/2 (0%)
Ig 521..615 CDD:472250 29/121 (24%)
Ig strand B 538..542 CDD:409353 0/3 (0%)
Ig strand C 553..557 CDD:409353 0/3 (0%)
Ig strand E 577..581 CDD:409353 1/3 (33%)
Ig strand F 591..596 CDD:409353 3/4 (75%)
Ig strand G 604..607 CDD:409353 1/2 (50%)
FN3 613..707 CDD:238020 26/109 (24%)
FN3 683..>1051 CDD:442628 96/471 (20%)
fn3 817..905 CDD:394996 20/90 (22%)
fn3 918..1007 CDD:394996 23/132 (17%)
FN3 1041..1111 CDD:238020 19/114 (17%)
Bravo_FIGEY 1155..>1221 CDD:464016 16/96 (17%)

Return to query results.
Submit another query.