DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ROBO1 and Robo1

DIOPT Version :10

Sequence 1:XP_011532278.1 Gene:ROBO1 / 6091 HGNCID:10249 Length:1654 Species:Homo sapiens
Sequence 2:XP_017172382.1 Gene:Robo1 / 19876 MGIID:1274781 Length:1687 Species:Mus musculus


Alignment Length:243 Identity:50/243 - (20%)
Similarity:81/243 - (33%) Gaps:91/243 - (37%)


- Green bases have known domain annotations that are detailed below.


Human    29 EISRIQYEMEYTEGISQ---RMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVA---- 86
            |:|:   ...:.|||.:   .::..||.::......||...:.|.....|::.  ||.|::    
Mouse   206 EVSK---RWTFEEGIKRPYFHVKPLEKAQLKNWKEYLEFEIENGTHERVVVLF--ERCVISCALY 265

Human    87 ----------GNNEDVS-----FSRPADLDLIQSTPFKPLA--------------------LKT- 115
                      ..|..:.     |||...:.|    |.||:|                    |:| 
Mouse   266 EEFWIKYAKYMENHSIEGVRHVFSRACTVHL----PKKPMAHMLWAAFEEQQGNINEARIILRTF 326

Human   116 PPRVLTLSERPLDFLDLERPPTTPQNEEIRAVGRLKRERSMSENAVRQNGQLVRNDSLYGISNID 180
            ...||.|:...|..:.||           |..|.::....:.::|:| |.:.....|.|.|    
Mouse   327 EECVLGLAMVRLRRVSLE-----------RRHGNMEEAEHLLQDAIR-NAKSNNESSFYAI---- 375

Human   181 TTIEGTSDDLTVVDAASLRRQIIKLNRRLQ-----LLE--EENKERAK 221
                            .|.|.:.|:.:.|.     |||  |::||..|
Mouse   376 ----------------KLARHLFKIQKNLPKSRKVLLEAIEKDKENTK 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ROBO1XP_011532278.1 IgC_1_Robo 68..166 CDD:409490 27/137 (20%)
Ig strand A 68..72 CDD:409490 1/3 (33%)
Ig strand A' 75..80 CDD:409490 1/4 (25%)
Ig strand B 84..92 CDD:409490 2/21 (10%)
Ig strand C 98..103 CDD:409490 0/4 (0%)
Ig strand C' 106..108 CDD:409490 0/1 (0%)
Ig strand D 119..122 CDD:409490 2/2 (100%)
Ig strand E 125..131 CDD:409490 1/5 (20%)
Ig strand F 143..151 CDD:409490 2/7 (29%)
Ig strand G 154..166 CDD:409490 3/11 (27%)
IgI_2_Robo 173..258 CDD:409389 13/56 (23%)
Ig strand A 173..176 CDD:409389 1/2 (50%)
Ig strand A' 178..182 CDD:409389 0/3 (0%)
Ig strand B 186..193 CDD:409389 0/6 (0%)
Ig strand C 201..206 CDD:409389 1/4 (25%)
Ig strand C' 208..211 CDD:409389 1/7 (14%)
Ig strand D 217..221 CDD:409389 2/3 (67%)
Ig strand E 223..229 CDD:409389
Ig strand F 236..244 CDD:409389
Ig strand G 247..258 CDD:409389
IgI_3_Robo 265..347 CDD:409390
Ig strand A 265..268 CDD:409390
Ig strand A' 270..274 CDD:409390
Ig strand B 277..286 CDD:409390
Ig strand C 292..297 CDD:409390
Ig strand C' 300..303 CDD:409390
Ig strand D 306..311 CDD:409390
Ig strand E 312..319 CDD:409390
Ig strand F 326..334 CDD:409390
Ig strand G 337..347 CDD:409390
IgI_4_Robo 355..452 CDD:409391
Ig strand A 355..359 CDD:409391
Ig strand A' 361..365 CDD:409391
Ig strand B 371..379 CDD:409391
Ig strand C 382..389 CDD:409391
Ig strand C' 391..394 CDD:409391
Ig strand D 407..412 CDD:409391
Ig strand E 414..421 CDD:409391
Ig strand F 427..436 CDD:409391
FN3 428..882 CDD:442628
Ig strand G 438..449 CDD:409391
IgI_5_Robo 459..545 CDD:409544
Ig strand A 459..462 CDD:409544
Ig strand A' 466..469 CDD:409544
Ig strand B 475..482 CDD:409544
Ig strand C 488..493 CDD:409544
Ig strand C' 495..497 CDD:409544
Ig strand D 504..508 CDD:409544
Ig strand E 511..516 CDD:409544
Ig strand F 524..532 CDD:409544
Ig strand G 535..545 CDD:409544
FN3 564..650 CDD:238020
Robo1XP_017172382.1 IgC_1_Robo 101..199 CDD:409490
Ig strand A 101..105 CDD:409490
Ig strand A' 108..113 CDD:409490
Ig strand B 117..125 CDD:409490
Ig strand C 131..136 CDD:409490
Ig strand C' 139..141 CDD:409490
Ig strand D 152..155 CDD:409490
Ig strand E 158..164 CDD:409490
Ig strand F 176..184 CDD:409490
Ig strand G 187..199 CDD:409490
IgI_2_Robo 206..291 CDD:409389 17/89 (19%)
Ig strand A 206..209 CDD:409389 1/2 (50%)
Ig strand A' 211..215 CDD:409389 0/3 (0%)
Ig strand B 219..226 CDD:409389 0/6 (0%)
Ig strand C 234..239 CDD:409389 0/4 (0%)
Ig strand C' 241..244 CDD:409389 0/2 (0%)
Ig strand D 250..254 CDD:409389 1/3 (33%)
Ig strand E 256..262 CDD:409389 3/5 (60%)
Ig strand F 269..277 CDD:409389 0/7 (0%)
Ig strand G 280..291 CDD:409389 2/10 (20%)
IgI_3_Robo 298..380 CDD:409390 20/113 (18%)
Ig strand A 298..301 CDD:409390 1/2 (50%)
Ig strand A' 303..307 CDD:409390 0/3 (0%)
Ig strand B 310..319 CDD:409390 0/8 (0%)
Ig strand C 325..330 CDD:409390 1/4 (25%)
Ig strand C' 333..336 CDD:409390 1/2 (50%)
Ig strand D 339..344 CDD:409390 0/4 (0%)
Ig strand E 345..352 CDD:409390 2/6 (33%)
Ig strand F 359..367 CDD:409390 3/8 (38%)
Ig strand G 370..380 CDD:409390 4/29 (14%)
IgI_4_Robo 388..485 CDD:409391 8/20 (40%)
Ig strand A 388..392 CDD:409391 1/3 (33%)
Ig strand A' 394..398 CDD:409391 2/3 (67%)
Ig strand B 404..412 CDD:409391 2/4 (50%)
Ig strand C 415..422 CDD:409391
Ig strand C' 424..427 CDD:409391
Ig strand D 440..445 CDD:409391
Ig strand E 447..454 CDD:409391
Ig strand F 460..469 CDD:409391
FN3 461..897 CDD:442628
Ig strand G 471..482 CDD:409391
IgI_5_Robo 492..578 CDD:409544
Ig strand A 492..495 CDD:409544
Ig strand A' 499..502 CDD:409544
Ig strand B 508..515 CDD:409544
Ig strand C 521..526 CDD:409544
Ig strand C' 528..530 CDD:409544
Ig strand D 537..541 CDD:409544
Ig strand E 544..549 CDD:409544
Ig strand F 557..565 CDD:409544
Ig strand G 568..578 CDD:409544
FN3 597..683 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.