DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FKBP10 and Fkbp12

DIOPT Version :10

Sequence 1:XP_011523401.1 Gene:FKBP10 / 60681 HGNCID:18169 Length:601 Species:Homo sapiens
Sequence 2:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster


Alignment Length:88 Identity:43/88 - (48%)
Similarity:53/88 - (60%) Gaps:0/88 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    62 GDFVRYHYNGTFEDGKKFDSSYDRNTLVAIVVGVGRLITGMDRGLMGMCVNERRRLIVPPHLGYG 126
            |..|..||.||.:||.|||||.|||......:|.|.:|.|.|.|:..:.|.:|.:||..|...||
  Fly    20 GQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVAQLSVGQRAKLICSPDYAYG 84

Human   127 SIGLAGLIPPDATLYFDVVLLDV 149
            |.|..|:|||::||.|||.||.|
  Fly    85 SRGHPGVIPPNSTLTFDVELLKV 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FKBP10XP_011523401.1 FKBP_C 55..147 CDD:459735 40/84 (48%)
FKBP_C 167..259 CDD:459735
FKBP_C 279..371 CDD:459735
FKBP_C 392..502 CDD:459735
FRQ1 502..>587 CDD:444056
Fkbp12NP_523792.2 FkpA 3..107 CDD:440311 42/86 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.