DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CELF6 and HSH49

DIOPT Version :9

Sequence 1:NP_443072.3 Gene:CELF6 / 60677 HGNCID:14059 Length:481 Species:Homo sapiens
Sequence 2:NP_014964.1 Gene:HSH49 / 854497 SGDID:S000005846 Length:213 Species:Saccharomyces cerevisiae


Alignment Length:202 Identity:43/202 - (21%)
Similarity:76/202 - (37%) Gaps:45/202 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    48 LFVGQIPRGLDEQDLKPLFEEFGRIYELTVLKDRLTGLHKGCAFLTYCAR--------------- 97
            ::||.|...:.::.|..||.:...:..:...||::...::|.||:.:..:               
Yeast    11 VYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYAIKIMNNTVR 75

Human    98 --DSALKAQSALHEQKT--LPGMNRPIQVKPAASEGRGEDRKLFVGMLGKQQGEEDVRRLFQPFG 158
              |..:|.:...:...|  ||.......:.|.|        |||:..|......:.:.::|..||
Yeast    76 LYDRLIKVRQVTNSTGTTNLPSNISKDMILPIA--------KLFIKNLADSIDSDQLVKIFNKFG 132

Human   159 H-IEECTVLRSPDGTSKGCAFVKFGSQGEAQAAIRGLHGSRTMAGASSSLVVKLA---------- 212
            . |.|..:....:|..| ||:|.|....:|..||:.|:....   |::.:.|..|          
Yeast   133 KLIREPEIFYLSNGKLK-CAYVYFEDFEKADLAIKSLNNQLV---ANNRITVDYAFKENGKGNAK 193

Human   213 ---DTDR 216
               |.||
Yeast   194 YGDDVDR 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CELF6NP_443072.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
RRM1_CELF3_4_5_6 41..127 CDD:241076 17/97 (18%)
ELAV_HUD_SF 48..477 CDD:273741 43/202 (21%)
RRM2_CELF3_4_5_6 133..213 CDD:241079 22/93 (24%)
RRM3_CELF3_4_5_6 392..470 CDD:241083
HSH49NP_014964.1 PABP-1234 10..>208 CDD:130689 43/202 (21%)
RRM1_SF3B4 11..85 CDD:409771 13/73 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54704
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.