DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BCL7A and BCL7-like

DIOPT Version :9

Sequence 1:NP_066273.1 Gene:BCL7A / 605 HGNCID:1004 Length:231 Species:Homo sapiens
Sequence 2:NP_572562.1 Gene:BCL7-like / 31890 FlyBaseID:FBgn0026149 Length:154 Species:Drosophila melanogaster


Alignment Length:163 Identity:62/163 - (38%)
Similarity:84/163 - (51%) Gaps:31/163 - (19%)


- Green bases have known domain annotations that are detailed below.


Human     4 RSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEPKVDDKNKNKKKGKD 68
            |||||||||||||||||||.|::|||.|||||||:.||:::||||||:.       :.::||.|.
  Fly     3 RSVRAETRSRAKDDIKRVMQAVDKVRHWEKKWVTISDTTMKIYKWVPIA-------SASEKKAKL 60

Human    69 EKCGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPNSAVPS-DGTEAK- 131
            |            ||||...:...... |.:......|.:..::....|.|....|| .|..|: 
  Fly    61 E------------SSPGSAAVRRPPPG-SGVTPVGGSKSDKENSQKGTPTPPQITPSYQGLTAED 112

Human   132 -------VDEAQADGKEHPGAEDASDEQNSQSS 157
                   |.::|  |.:...:...|::.|||.|
  Fly   113 SNTCFSVVSDSQ--GADFVSSMPFSEDSNSQGS 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BCL7ANP_066273.1 BCL_N 4..50 CDD:398405 36/45 (80%)
BCL7-likeNP_572562.1 BCL_N 2..49 CDD:282557 36/45 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I7924
eggNOG 1 0.900 - - E1_KOG4095
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I5069
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1517597at2759
OrthoFinder 1 1.000 - - FOG0001798
OrthoInspector 1 1.000 - - otm41966
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12767
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2423
SonicParanoid 1 1.000 - - X1157
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.960

Return to query results.
Submit another query.