DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELOVL5 and CG31523

DIOPT Version :9

Sequence 1:NP_001229757.1 Gene:ELOVL5 / 60481 HGNCID:21308 Length:326 Species:Homo sapiens
Sequence 2:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster


Alignment Length:296 Identity:106/296 - (35%)
Similarity:155/296 - (52%) Gaps:39/296 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    20 DTRVKGWFLLDNYIPTFICSVIYLLI-VWLGPKYMRNKQPFSCRGILVVYNLGLTLLSLYMFCES 83
            |.||..:|||.:.:||....:.|... ..|||:.|..::|...|.:|||||...|:.|.::|.| 
  Fly    21 DPRVNDFFLLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVVYNAIQTIFSAWIFYE- 84

Human    84 KREQPRRSACASRTDPSTQQQLPENRLVTGVWEGKYNFFCQGT--RTAGESDMKIIRVLWWYYFS 146
                                     .|::| |.|.|:..||..  .|.|.: |:::.:.||||.|
  Fly    85 -------------------------YLMSG-WWGHYSLKCQPVDYSTTGLA-MRMVNICWWYYIS 122

Human   147 KLIEFMDTFFFILRKNNHQITVLHVYHHASMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYY 211
            |..||.||.||||||.|..::.|||.||..|....|..:.:.|.|||.|.|.||||:|::||.||
  Fly   123 KFTEFFDTLFFILRKKNEHVSTLHVIHHGCMPFSVWMGLKFAPGGHSTFFALLNSFVHIVMYFYY 187

Human   212 GLSSV-PSMRPYLWWKKYITQGQLLQFVLTIIQTSCGVIWPCTFPLGWLYFQIG-YMISLIALFT 274
            .:::: |..:.|:|||||:|..|::|||.........:...|.:|.|::.: || :.:..:.||:
  Fly   188 MIAAMGPKYQKYIWWKKYLTTFQMVQFVAIFTHQFQLLFRECDYPKGFMVW-IGLHGVMFLFLFS 251

Human   275 NFYIQTYNKKGASRRKDHLK--DHQNGSMAAVNGHT 308
            :||...| ...|.||:..:|  .:.|||  |.|||:
  Fly   252 DFYKAKY-LNAARRRRQAVKANGYANGS--ASNGHS 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELOVL5NP_001229757.1 ELO 27..288 CDD:366492 93/265 (35%)
CG31523NP_001262255.1 ELO 28..265 CDD:279492 93/266 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.