DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF4 and CG17329

DIOPT Version :9

Sequence 1:NP_001171938.1 Gene:RNF4 / 6047 HGNCID:10067 Length:190 Species:Homo sapiens
Sequence 2:NP_609784.2 Gene:CG17329 / 34958 FlyBaseID:FBgn0028896 Length:162 Species:Drosophila melanogaster


Alignment Length:60 Identity:20/60 - (33%)
Similarity:34/60 - (56%) Gaps:4/60 - (6%)


- Green bases have known domain annotations that are detailed below.


Human   131 SCPICMDGYSEIVQNG-RLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIY 189
            :|.||:..:::   || ..:||..|||:|.|.|:..:::..:.||.||::..|.....||
  Fly    99 TCSICLLPWTD---NGIHRLVSLRCGHLFGSSCIHMAIRRNHRCPICRRRARHFHVRRIY 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF4NP_001171938.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Required for ubiquitination activity. /evidence=ECO:0000250 1..16
Mediates interaction with TRPS1. /evidence=ECO:0000250 4..61
SUMO interaction motif 1. /evidence=ECO:0000269|PubMed:18408734 36..39
SUMO interaction motif 2. /evidence=ECO:0000269|PubMed:18408734 46..49
SUMO interaction motif 3. /evidence=ECO:0000269|PubMed:18408734 57..59
SUMO interaction motif 4. /evidence=ECO:0000269|PubMed:18408734 67..70
RING-HC_RNF4 127..180 CDD:319447 17/49 (35%)
RING-HC finger (C3HC4-type) 132..176 CDD:319447 15/44 (34%)
CG17329NP_609784.2 zf-RING_2 99..143 CDD:290367 15/46 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001208
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.