DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TGIF2 and hth

DIOPT Version :10

Sequence 1:NP_068581.1 Gene:TGIF2 / 60436 HGNCID:15764 Length:237 Species:Homo sapiens
Sequence 2:NP_476576.1 Gene:hth / 41273 FlyBaseID:FBgn0001235 Length:487 Species:Drosophila melanogaster


Alignment Length:151 Identity:45/151 - (29%)
Similarity:72/151 - (47%) Gaps:17/151 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     2 SDSDLGEDEGL----LSLAGKR--KRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNL 60
            |::.:|..||.    ...:||:  |:||..||.:..|||.||:.|..:.||||.:|..|:..|.|
  Fly   343 SNASIGSGEGTGEEDDDASGKKNQKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGL 407

Human    61 SVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVL 125
            ::||:.|||||||||::..|:.:.    |:...:...|       |.|.....:...:.:..:::
  Fly   408 TILQVNNWFINARRRIVQPMIDQS----NRAVYTPHPG-------PSGYGHDAMGYMMDSQAHMM 461

Human   126 SLSVCSMPLHSGQGEKPAAPF 146
            .........|.|....|.|.:
  Fly   462 HRPPGDPGFHQGYPHYPPAEY 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TGIF2NP_068581.1 Homeobox_KN 37..75 CDD:428673 19/37 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..106 2/18 (11%)
Repressive function 103..237 6/44 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..193
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..237
hthNP_476576.1 Meis_PKNOX_N 127..211 CDD:465140
Homeobox_KN 384..422 CDD:428673 19/37 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.