DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TGIF2 and vis

DIOPT Version :10

Sequence 1:NP_068581.1 Gene:TGIF2 / 60436 HGNCID:15764 Length:237 Species:Homo sapiens
Sequence 2:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster


Alignment Length:81 Identity:59/81 - (72%)
Similarity:70/81 - (86%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    19 RKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRK 83
            |||||||||.|||||:.|||.||||||||:.||.:||.:.||:|||:||||||||||:||:|:|:
  Fly    92 RKRRGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRR 156

Human    84 DGKDPNQFTISRRGGK 99
            :|.||..|||||||.|
  Fly   157 EGNDPLHFTISRRGKK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TGIF2NP_068581.1 Homeobox_KN 37..75 CDD:428673 27/37 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..106 10/13 (77%)
Repressive function 103..237
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..193
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..237
visNP_788337.1 Homeobox_KN 110..148 CDD:428673 27/37 (73%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.