DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TGIF2 and CG11617

DIOPT Version :10

Sequence 1:NP_068581.1 Gene:TGIF2 / 60436 HGNCID:15764 Length:237 Species:Homo sapiens
Sequence 2:NP_608502.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster


Alignment Length:202 Identity:50/202 - (24%)
Similarity:78/202 - (38%) Gaps:65/202 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    18 KRKRRGNL----PKESV----------------KILRDWLYLHRYNAYPSEQEKLSLSGQTNLSV 62
            ||.||.:.    |:|.:                ::|:|||...|.|.|||.:||..|:.:|.|:.
  Fly     8 KRNRRHSRRAWPPEEELHPASRATKRLFTPDIKRMLKDWLIRRRENPYPSREEKKQLAAETGLTY 72

Human    63 LQICNWFINARRRLLPDMLRKDGKD----PNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTN 123
            .||||||.|.||:|......|..|.    ...:..:.||              :|...|:.:..:
  Fly    73 TQICNWFANWRRKLKNSEREKAKKSWGHLIKNYNHNARG--------------NVEQFSISSEDS 123

Human   124 VLSLSVCSMPLHSGQGE------------------KPAAPFPRGELESPKPLVTPGST-LTLLTR 169
            :....:.|.|....:|:                  :|::|:        ||::..||. ||....
  Fly   124 IWEEEMHSCPAEDDEGDDNEEFSSHSTGSDGNANNEPSSPY--------KPILFVGSAGLTERIS 180

Human   170 AEAGSPT 176
            |:.|..|
  Fly   181 AQTGGKT 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TGIF2NP_068581.1 Homeobox_KN 37..75 CDD:428673 19/37 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..106 2/22 (9%)
Repressive function 103..237 16/93 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..193 2/5 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..237
CG11617NP_608502.1 homeodomain 29..90 CDD:238039 24/60 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.