DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TGIF2 and exd

DIOPT Version :10

Sequence 1:NP_068581.1 Gene:TGIF2 / 60436 HGNCID:15764 Length:237 Species:Homo sapiens
Sequence 2:NP_523360.1 Gene:exd / 32567 FlyBaseID:FBgn0000611 Length:376 Species:Drosophila melanogaster


Alignment Length:126 Identity:39/126 - (30%)
Similarity:65/126 - (51%) Gaps:13/126 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    15 LAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPD 79
            |..:|||| |..|::.:||.::.|.|..|.||||:.|..|:.:..::|.|:.|||.|.|.|...:
  Fly   236 LDARRKRR-NFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKN 299

Human    80 MLRKDGKDPNQFTISRRGGKASDVAL---PRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSG 137
             :.|..::.|.:...:..| ||..::   |.|::..:::   |||..    .....|:.||
  Fly   300 -IGKAQEEANLYAAKKAAG-ASPYSMAGPPSGTTTPMMS---PAPPQ----DSMGYPMGSG 351

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
TGIF2NP_068581.1 Homeobox_KN 37..75 CDD:428673 16/37 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..106 4/21 (19%)
Repressive function 103..237 8/38 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..193
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..237