DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNASEL and asb6

DIOPT Version :9

Sequence 1:NP_066956.1 Gene:RNASEL / 6041 HGNCID:10050 Length:741 Species:Homo sapiens
Sequence 2:NP_001016375.1 Gene:asb6 / 549129 XenbaseID:XB-GENE-974870 Length:426 Species:Xenopus tropicalis


Alignment Length:378 Identity:93/378 - (24%)
Similarity:146/378 - (38%) Gaps:96/378 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    76 ELLLRHGADPVLRKKNGATPFIL-AAIAGSVKLLKLFLSKGADVN-ECDFYGFTAFMEAAVYGKV 138
            |||.||......  |.|.:..:| .|..|.|...|:.|..|||:: |.....:||...|.:..:.
 Frog    55 ELLERHSQSSFY--KEGVSYSLLKVAELGMVPSAKILLQFGADLSFEDPVTYYTALHIAVLRNQP 117

Human   139 KALKFLYKRGANVNLRRKTKEDQERLRKGGATALMDAA--EKGHVEVLKILLDEMGADVNACDNM 201
            :.::.|.:.||::|.|.:..|          ::.:|.|  |...:..|:.|| |:.|||||.|..
 Frog   118 EMVELLVQSGADINKRDRIHE----------SSPLDLASEEPERLPCLQRLL-ELSADVNAADKN 171

Human   202 GRNALIHALLSSDDSDVEAITH--LLLDHGADVNVRGERGKTPLILAVEKKH---LGLVQRLLEQ 261
            |:.||:|||.|||...:..|.:  |||:.||||.            |..|.:   ...:..||  
 Frog   172 GKTALLHALASSDGVQIHNIENIRLLLEGGADVK------------ATTKDYDTVFSCIIFLL-- 222

Human   262 EHIEINDTDSDGKTALLLAVELKL-----KKIAELLCKRGAS-TDC---GDLVMTARRNY--DHS 315
                       |:|......|.||     .::::||...||. ::|   ..|..|..:::  ...
 Frog   223 -----------GETVGCDQEEAKLINHFCFRVSQLLIAHGADPSECPSHESLTHTCLKSFKLHFP 276

Human   316 LVKVLLSHGAKEDFHPPAEDWKPQSSHWGAALKDLHRIYRPMIGKLKFFIDEKYKIADTSEGGIY 380
            |::.||..||..:.          |.|..:.....|.:...:...|           .|.:....
 Frog   277 LLRFLLESGASYNC----------SQHGPSCWSGFHIVLERLCSYL-----------GTCDECDS 320

Human   381 LGFYEKQEVAVKTFCEGSPRAQ-----------------REVSCLQSSRENSH 416
            |...:|.|.|:......||:.:                 :.|:.|||.::..|
 Frog   321 LQLLQKAECALDLMIAHSPQVKLPRNFEINTAGCNTHVDKVVALLQSLKQLEH 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNASELNP_066956.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
ANK repeat 24..56 CDD:293786
ANK 1 24..53
Ank_2 29..122 CDD:289560 17/47 (36%)
ANK 2 58..87 5/10 (50%)
ANK 59..188 CDD:238125 30/115 (26%)
ANK repeat 59..89 CDD:293786 5/12 (42%)
ANK repeat 91..122 CDD:293786 11/32 (34%)
ANK 3 91..120 10/30 (33%)
Ank_2 96..199 CDD:289560 31/106 (29%)
ANK repeat 124..154 CDD:293786 7/29 (24%)
ANK 4 124..153 6/28 (21%)
ANK repeat 167..199 CDD:293786 12/33 (36%)
ANK 5 167..197 10/31 (32%)
Ank_2 172..270 CDD:289560 34/104 (33%)
ANK 196..321 CDD:238125 37/140 (26%)
ANK repeat 201..236 CDD:293786 17/36 (47%)
ANK 6 201..234 17/34 (50%)
2-5A binding (P-loop) 1 229..242 4/12 (33%)
ANK 7 238..268 4/32 (13%)
Ank_2 243..326 CDD:289560 20/96 (21%)
2-5A binding (P-loop) 2 253..275 3/21 (14%)
ANK repeat 272..326 CDD:293786 16/64 (25%)
ANK 8 272..301 9/34 (26%)
ANK 9 303..329 7/27 (26%)
PKc_like 375..587 CDD:304357 11/59 (19%)
Pkinase 387..586 CDD:278497 9/47 (19%)
RNase_RNase-L 590..708 CDD:199218
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 715..741
asb6NP_001016375.1 PHA03095 63..>289 CDD:222980 72/263 (27%)
ANK repeat 74..100 CDD:293786 9/25 (36%)
ANK repeat 106..134 CDD:293786 7/27 (26%)
ANK repeat 137..169 CDD:293786 13/42 (31%)
ANK repeat 171..206 CDD:293786 17/46 (37%)
SOCS_ASB6 373..416 CDD:239695 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.