| Sequence 1: | NP_066956.1 | Gene: | RNASEL / 6041 | HGNCID: | 10050 | Length: | 741 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001016261.1 | Gene: | sdr39u1 / 549015 | XenbaseID: | XB-GENE-1015181 | Length: | 300 | Species: | Xenopus tropicalis |
| Alignment Length: | 266 | Identity: | 53/266 - (19%) |
|---|---|---|---|
| Similarity: | 82/266 - (30%) | Gaps: | 105/266 - (39%) |
- Green bases have known domain annotations that are detailed below.
|
Human 397 GSPRAQREVSCLQSSRENSHLVTFYGSESHRGHLF------VCVTLCEQTLEACLDVHRGEDVEN 455
Human 456 E----EDEFARNVLSS-------IFKAVQE---------LHLSCGY-----THQ----------- 484
Human 485 -------------DLQPQNILIDSKKAAHLADFDK------------SIKW-----------AGD 513
Human 514 PQEVKRDLEDLGRLVLYVVKKGSISFEDLKAQSNEEVVQLSPDEETKDLIHRLFHPGEHVRDCLS 578
Human 579 DLLGHP 584 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RNASEL | NP_066956.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..21 | ||
| ANK repeat | 24..56 | CDD:293786 | |||
| ANK 1 | 24..53 | ||||
| Ank_2 | 29..122 | CDD:289560 | |||
| ANK 2 | 58..87 | ||||
| ANK | 59..188 | CDD:238125 | |||
| ANK repeat | 59..89 | CDD:293786 | |||
| ANK repeat | 91..122 | CDD:293786 | |||
| ANK 3 | 91..120 | ||||
| Ank_2 | 96..199 | CDD:289560 | |||
| ANK repeat | 124..154 | CDD:293786 | |||
| ANK 4 | 124..153 | ||||
| ANK repeat | 167..199 | CDD:293786 | |||
| ANK 5 | 167..197 | ||||
| Ank_2 | 172..270 | CDD:289560 | |||
| ANK | 196..321 | CDD:238125 | |||
| ANK repeat | 201..236 | CDD:293786 | |||
| ANK 6 | 201..234 | ||||
| 2-5A binding (P-loop) 1 | 229..242 | ||||
| ANK 7 | 238..268 | ||||
| Ank_2 | 243..326 | CDD:289560 | |||
| 2-5A binding (P-loop) 2 | 253..275 | ||||
| ANK repeat | 272..326 | CDD:293786 | |||
| ANK 8 | 272..301 | ||||
| ANK 9 | 303..329 | ||||
| PKc_like | 375..587 | CDD:304357 | 53/266 (20%) | ||
| Pkinase | 387..586 | CDD:278497 | 53/266 (20%) | ||
| RNase_RNase-L | 590..708 | CDD:199218 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 715..741 | ||||
| sdr39u1 | NP_001016261.1 | SDR_a8 | 2..299 | CDD:187553 | 53/266 (20%) |
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| NCBI | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||