| Sequence 1: | NP_066956.1 | Gene: | RNASEL / 6041 | HGNCID: | 10050 | Length: | 741 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001263772.1 | Gene: | mask-1 / 177927 | WormBaseID: | WBGene00011240 | Length: | 2622 | Species: | Caenorhabditis elegans |
| Alignment Length: | 407 | Identity: | 95/407 - (23%) |
|---|---|---|---|
| Similarity: | 168/407 - (41%) | Gaps: | 117/407 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Human 4 RDHNNPQEGPTSSSGRRAAVE-------DNHLLIKAVQNEDVDLVQQLLEGGANVNFQEEEGGWT 61
Human 62 PL------------------HNAVQM----------------SREDIVELLLRHGADPVLRKKNG 92
Human 93 ATPFILAAIAGSVKLLKLFLSKGADVNE--CDFYGFTAFMEAAVYGKVKALKFLYKRGANVNLRR 155
Human 156 KTKEDQ------------------------ERLRKGGATALMDAAEKGHVEVLKILLDEMGADVN 196
Human 197 ACDNMGRNALIHALLSSDDSDVEAITHLLLDHGADVNVRGERGKTPLILAVEKKHLGLVQRLLE- 260
Human 261 --------------------QEHIEI------------NDTDSDGKTALLLAVELKLKKIAELLC 293
Human 294 KRGASTDCGDLVMTARR 310 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RNASEL | NP_066956.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..21 | 4/16 (25%) | |
| ANK repeat | 24..56 | CDD:293786 | 11/38 (29%) | ||
| ANK 1 | 24..53 | 11/35 (31%) | |||
| Ank_2 | 29..122 | CDD:289560 | 34/128 (27%) | ||
| ANK 2 | 58..87 | 15/62 (24%) | |||
| ANK | 59..188 | CDD:238125 | 43/188 (23%) | ||
| ANK repeat | 59..89 | CDD:293786 | 15/63 (24%) | ||
| ANK repeat | 91..122 | CDD:293786 | 8/32 (25%) | ||
| ANK 3 | 91..120 | 7/28 (25%) | |||
| Ank_2 | 96..199 | CDD:289560 | 31/128 (24%) | ||
| ANK repeat | 124..154 | CDD:293786 | 8/29 (28%) | ||
| ANK 4 | 124..153 | 7/28 (25%) | |||
| ANK repeat | 167..199 | CDD:293786 | 14/31 (45%) | ||
| ANK 5 | 167..197 | 12/29 (41%) | |||
| Ank_2 | 172..270 | CDD:289560 | 36/130 (28%) | ||
| ANK | 196..321 | CDD:238125 | 32/148 (22%) | ||
| ANK repeat | 201..236 | CDD:293786 | 9/34 (26%) | ||
| ANK 6 | 201..234 | 8/32 (25%) | |||
| 2-5A binding (P-loop) 1 | 229..242 | 5/12 (42%) | |||
| ANK 7 | 238..268 | 13/62 (21%) | |||
| Ank_2 | 243..326 | CDD:289560 | 18/101 (18%) | ||
| 2-5A binding (P-loop) 2 | 253..275 | 9/54 (17%) | |||
| ANK repeat | 272..326 | CDD:293786 | 5/39 (13%) | ||
| ANK 8 | 272..301 | 2/28 (7%) | |||
| ANK 9 | 303..329 | 2/8 (25%) | |||
| PKc_like | 375..587 | CDD:304357 | |||
| Pkinase | 387..586 | CDD:278497 | |||
| RNase_RNase-L | 590..708 | CDD:199218 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 715..741 | ||||
| mask-1 | NP_001263772.1 | Ank_2 | 225..309 | CDD:289560 | |
| ANK | 257..382 | CDD:238125 | |||
| ANK repeat | 257..288 | CDD:293786 | |||
| ANK repeat | 290..323 | CDD:293786 | |||
| ANK repeat | 325..349 | CDD:293786 | |||
| Ank_2 | 366..464 | CDD:289560 | |||
| ANK | 402..528 | CDD:238125 | |||
| ANK repeat | 405..433 | CDD:293786 | |||
| ANK repeat | 440..468 | CDD:293786 | |||
| Ank_2 | 442..536 | CDD:289560 | |||
| ANK repeat | 470..504 | CDD:293786 | |||
| ANK repeat | 506..536 | CDD:293786 | |||
| ANK | 572..688 | CDD:238125 | |||
| ANK repeat | 572..599 | CDD:293786 | |||
| Ank_2 | 573..664 | CDD:289560 | |||
| ANK repeat | 600..631 | CDD:293786 | |||
| ANK repeat | 634..665 | CDD:293786 | |||
| ANK | 1243..1357 | CDD:238125 | 31/115 (27%) | ||
| Ank_2 | 1243..1334 | CDD:289560 | 25/92 (27%) | ||
| ANK repeat | 1269..1301 | CDD:293786 | 5/32 (16%) | ||
| ANK | 1301..1426 | CDD:238125 | 28/124 (23%) | ||
| ANK repeat | 1303..1334 | CDD:293786 | 10/30 (33%) | ||
| Ank_2 | 1308..1401 | CDD:289560 | 27/92 (29%) | ||
| ANK repeat | 1336..1367 | CDD:293786 | 8/30 (27%) | ||
| ANK repeat | 1371..1401 | CDD:293786 | 8/29 (28%) | ||
| Ank_2 | 1376..1467 | CDD:289560 | 22/91 (24%) | ||
| ANK repeat | 1404..1436 | CDD:293786 | 2/31 (6%) | ||
| ANK | 1434..1560 | CDD:238125 | 38/128 (30%) | ||
| ANK repeat | 1438..1467 | CDD:293786 | 12/29 (41%) | ||
| Ank_2 | 1443..1537 | CDD:289560 | 32/96 (33%) | ||
| ANK repeat | 1475..1504 | CDD:293786 | 9/28 (32%) | ||
| ANK repeat | 1506..1537 | CDD:293786 | 10/30 (33%) | ||
| ANK repeat | 1539..1571 | CDD:293786 | 4/31 (13%) | ||
| KH-I | 1811..1875 | CDD:238053 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||