DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNASEL and C18H2.5

DIOPT Version :9

Sequence 1:NP_066956.1 Gene:RNASEL / 6041 HGNCID:10050 Length:741 Species:Homo sapiens
Sequence 2:NP_741231.2 Gene:C18H2.5 / 176082 WormBaseID:WBGene00015992 Length:1195 Species:Caenorhabditis elegans


Alignment Length:710 Identity:135/710 - (19%)
Similarity:234/710 - (32%) Gaps:262/710 - (36%)


- Green bases have known domain annotations that are detailed below.


Human   145 YKRGANVNLRRKTKEDQERLRKGGATALMDAAEKGHVEVLKI---LLDEMGAD--VNAC------ 198
            |||     :...|..|::.|                :.:||:   |:..:.:|  ||..      
 Worm   109 YKR-----IYESTNGDKDDL----------------LRILKLNEDLMTSVSSDYVVNKTKIHDFF 152

Human   199 DNMGRNALIHALLSSDDSDVEAITHL--LLDHGADVNVRGERGKTPLILAVEKK----------- 250
            |::|.|:.|..|...:::.||.|...  :::.....|   |..|...|:.::.:           
 Worm   153 DHLGNNSTISRLKGCNETHVEMIVEFWNVINEKKAAN---EDDKKIAIVTLKNRIPEVRQCMTSI 214

Human   251 -----------HLGLVQR----------LLEQEHIEINDTDSDGKTALLLAVELKLKKIAELLCK 294
                       .:|.|.|          |.:::.||..:..:|.:         |||.||:.:.|
 Worm   215 KEYYSFVYPISKVGEVFRNIFSARATVELFKKKQIEYENFPNDLE---------KLKNIAKKIIK 270

Human   295 RGASTDCG---DLVMTARRNYDHSLVKV------LLSHGAKEDFHPPAED----WKPQSSHWGAA 346
            ...:....   ::.||.:.:.|....|.      |:.:|..||.....||    |..:....|.:
 Worm   271 DWEAPQVDVYKEVSMTVQLHKDMVQNKTMAVWLSLVGYGLIEDLKMVREDLNSVWFKEKVANGKS 335

Human   347 LKDLHRIYRPMIGKLKFFIDEKYKIADTSEGGIYLGFYEKQEVAVKTFCEGSPRAQREVSCLQSS 411
            :|.|.       ..|:.|    :|.::      |.|..|...:..|.|.    :|:|: :.|:| 
 Worm   336 IKFLE-------NSLEAF----FKFSE------YTGKLETTWIKFKAFF----KAERK-NLLES- 377

Human   412 RENSHLVTFYGSESHRGHLFVCVTLCEQTLEACLDVHRGED-VEN-------------EEDEFAR 462
                  ::||.|                 :..|.||..||. :||             :.::|||
 Worm   378 ------LSFYSS-----------------INQCSDVASGEGAIENMKKIYNGCWKGSAQTEDFAR 419

Human   463 -----NVLSSIFKAVQELHLSCGYT--HQDLQPQNILIDSKKAAHLADFDKSIKWAGDPQEVKRD 520
                 ..||.:...:.|:...|..|  ..|.......:||....:|.:.        :|||...:
 Worm   420 FDEHSKTLSDLNSTIFEVLAWCNETVKQNDFDVMETALDSLNNLNLENL--------NPQETINE 476

Human   521 LEDLGRLVLYVVKKGSISFEDLKAQSNEEVVQLSPDEETKDLIHRLFHPGEHV------------ 573
            :.::.            :||||. ...|..::....::..|..::|.|....|            
 Worm   477 VREIQ------------NFEDLN-DFFERFLRFHLLQKKYDTDYQLLHKVNLVDVMEETAANLTK 528

Human   574 ------RDCL-------SDLLGHPFFWTWESRYRTLRNVGNESDIK------------------- 606
                  ..||       |.:.....|.|      ::|.:||.||.|                   
 Worm   529 SKSIANLKCLKMKEFQSSKIHSTVEFIT------SVRRIGNSSDHKKIKDAVKIYSDMRTDYVAV 587

Human   607 ------TRKSESEILRLLQPGPSEHSKSFDKWTTKINE---CVMKKMNKFYEKRGNF-----YQN 657
                  ||:...:..:|.:..|....|...|..||:.:   | ::.:.:.|:.|...     |.|
 Worm   588 EKFLEETRRQSKQNEQLTKQNPVLKFKHSMKIATKLAKGMIC-LRDLIESYKLRSEILNSANYDN 651

Human   658 TVGDLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQ--NTEYRKH 715
            .|.|.:       .:.:|.|..| :...|.|..        |:.:|..:|.  |.|.||:
 Worm   652 GVNDKI-------ANFNENKQVK-EFWSGSPGY--------LLEHVVRELDNLNMEARKY 695

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNASELNP_066956.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
ANK repeat 24..56 CDD:293786
ANK 1 24..53
Ank_2 29..122 CDD:289560
ANK 2 58..87
ANK 59..188 CDD:238125 8/45 (18%)
ANK repeat 59..89 CDD:293786
ANK repeat 91..122 CDD:293786
ANK 3 91..120
Ank_2 96..199 CDD:289560 12/64 (19%)
ANK repeat 124..154 CDD:293786 3/8 (38%)
ANK 4 124..153 3/7 (43%)
ANK repeat 167..199 CDD:293786 6/42 (14%)
ANK 5 167..197 5/34 (15%)
Ank_2 172..270 CDD:289560 24/142 (17%)
ANK 196..321 CDD:238125 30/173 (17%)
ANK repeat 201..236 CDD:293786 8/36 (22%)
ANK 6 201..234 7/34 (21%)
2-5A binding (P-loop) 1 229..242 3/12 (25%)
ANK 7 238..268 8/61 (13%)
Ank_2 243..326 CDD:289560 20/123 (16%)
2-5A binding (P-loop) 2 253..275 7/31 (23%)
ANK repeat 272..326 CDD:293786 13/62 (21%)
ANK 8 272..301 7/28 (25%)
ANK 9 303..329 7/31 (23%)
PKc_like 375..587 CDD:304357 46/257 (18%)
Pkinase 387..586 CDD:278497 43/244 (18%)
RNase_RNase-L 590..708 CDD:199218 28/150 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 715..741 0/1 (0%)
C18H2.5NP_741231.2 WSN 40..108 CDD:197734
Ank_4 856..909 CDD:290365
ANK 860..>924 CDD:238125
ANK repeat 860..886 CDD:293786
ANK repeat 888..922 CDD:293786
BRCT 964..1044 CDD:214602
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.