DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNASEL and wee-1.3

DIOPT Version :9

Sequence 1:NP_066956.1 Gene:RNASEL / 6041 HGNCID:10050 Length:741 Species:Homo sapiens
Sequence 2:NP_496095.1 Gene:wee-1.3 / 174531 WormBaseID:WBGene00006940 Length:677 Species:Caenorhabditis elegans


Alignment Length:379 Identity:80/379 - (21%)
Similarity:134/379 - (35%) Gaps:98/379 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   268 DTDSDGKTALLLAVELKLKKIAELLCKRGASTDCGDLVMTARRNYDHSLVKVLLSHGAKEDFHPP 332
            |:..:|:::.|..|..:|.:|..::.:...||......:|.|                   |..|
 Worm    11 DSIRNGQSSPLPQVTPRLPQIPMMMRETPLSTKRERQAITPR-------------------FRRP 56

Human   333 A----EDWKPQSSHWGAALKDLHRIYRPMIGK-----------LKFFIDEKYKIADTSEGGIYLG 382
            |    :...|..|.|....:.:..:..|...|           .:.|.::.::|.:....|.:..
 Worm    57 APKMIKTMPPTRSIWSVRKESVPLLVTPQGPKPLESPKYDHTNAQSFFEQVFQIDEIIGRGSFGE 121

Human   383 FY------EKQEVAVKTFCEGSPRAQREVSCLQSSRE------NSHLVTFYGSESHRGHLFVCVT 435
            .:      :.|..|||...  :|..|..:|..:.:..      :.:||.||.:....|.|::...
 Worm   122 VFAARCREDSQLYAVKVSL--APIRQHSISKYREAESHMIIPPHKNLVKFYRAWEETGRLYIQTE 184

Human   436 LCEQT-LEACLDVHRGEDVENEEDEFARNVLSSIFKAVQELHLSCGYTHQDLQPQNILIDSKKAA 499
            ||:|: |:.|.:.|     ...|||. .|:...:.:||..|| |....|.|::|:||.:......
 Worm   185 LCDQSLLKYCTEKH-----ALPEDEI-WNIFVDLLQAVHHLH-SNDMIHDDIKPENIFLTKDMIC 242

Human   500 HLADFDKSIKWAGDPQEVK----------------------RDLEDLGRLVLYVVKKGSISFEDL 542
            .|.||...|. ..:|.:||                      .|:..||..:|...       .||
 Worm   243 KLGDFGLVIN-LKNPNDVKSAEEGDSKYLAPEVLNGRPTKSSDIFSLGMTILEAT-------TDL 299

Human   543 KAQSN-EEVVQLS----PDE-------ETKDLIHRLFHPGEHVRDCLSDLLGHP 584
            ...|| :...|:.    ||.       :.:.||..:......:|....|||.||
 Worm   300 DVPSNGDSWHQIRNGQIPDRFFAGISTDLRSLIALMLDSDPRIRPTSRDLLDHP 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNASELNP_066956.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
ANK repeat 24..56 CDD:293786
ANK 1 24..53
Ank_2 29..122 CDD:289560
ANK 2 58..87
ANK 59..188 CDD:238125
ANK repeat 59..89 CDD:293786
ANK repeat 91..122 CDD:293786
ANK 3 91..120
Ank_2 96..199 CDD:289560
ANK repeat 124..154 CDD:293786
ANK 4 124..153
ANK repeat 167..199 CDD:293786
ANK 5 167..197
Ank_2 172..270 CDD:289560 1/1 (100%)
ANK 196..321 CDD:238125 10/52 (19%)
ANK repeat 201..236 CDD:293786
ANK 6 201..234
2-5A binding (P-loop) 1 229..242
ANK 7 238..268 80/379 (21%)
Ank_2 243..326 CDD:289560 10/57 (18%)
2-5A binding (P-loop) 2 253..275 2/6 (33%)
ANK repeat 272..326 CDD:293786 9/53 (17%)
ANK 8 272..301 7/28 (25%)
ANK 9 303..329 2/25 (8%)
PKc_like 375..587 CDD:304357 60/257 (23%)
Pkinase 387..586 CDD:278497 59/239 (25%)
RNase_RNase-L 590..708 CDD:199218
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 715..741
wee-1.3NP_496095.1 PKc_Myt1 106..353 CDD:270952 59/263 (22%)
S_TKc 108..355 CDD:214567 61/263 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.