| Sequence 1: | NP_066956.1 | Gene: | RNASEL / 6041 | HGNCID: | 10050 | Length: | 741 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_017952998.2 | Gene: | bard1 / 100498289 | XenbaseID: | XB-GENE-492035 | Length: | 781 | Species: | Xenopus tropicalis |
| Alignment Length: | 201 | Identity: | 55/201 - (27%) |
|---|---|---|---|
| Similarity: | 87/201 - (43%) | Gaps: | 18/201 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Human 23 VEDNH----LLIKAVQNEDVDLVQQLLEGGANVNFQEEEGGWTPLHNAVQMSREDIVELLLRHGA 83
Human 84 DPVLRKKNGATPFILAAIAGSVKLLKLFLSKGADVNECDFYGFTAFMEAAVYGKVKALKFLYKRG 148
Human 149 ANVNLRRKTKEDQERLRKGG-----ATALMDAAEKGHVEVLKILLDEMGADVNACDNMGRNALIH 208
Human 209 ALLSSD 214 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RNASEL | NP_066956.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..21 | ||
| ANK repeat | 24..56 | CDD:293786 | 12/35 (34%) | ||
| ANK 1 | 24..53 | 11/32 (34%) | |||
| Ank_2 | 29..122 | CDD:289560 | 34/92 (37%) | ||
| ANK 2 | 58..87 | 15/28 (54%) | |||
| ANK | 59..188 | CDD:238125 | 37/133 (28%) | ||
| ANK repeat | 59..89 | CDD:293786 | 15/29 (52%) | ||
| ANK repeat | 91..122 | CDD:293786 | 9/30 (30%) | ||
| ANK 3 | 91..120 | 9/28 (32%) | |||
| Ank_2 | 96..199 | CDD:289560 | 23/107 (21%) | ||
| ANK repeat | 124..154 | CDD:293786 | 5/29 (17%) | ||
| ANK 4 | 124..153 | 5/28 (18%) | |||
| ANK repeat | 167..199 | CDD:293786 | 6/36 (17%) | ||
| ANK 5 | 167..197 | 6/34 (18%) | |||
| Ank_2 | 172..270 | CDD:289560 | 7/43 (16%) | ||
| ANK | 196..321 | CDD:238125 | 2/19 (11%) | ||
| ANK repeat | 201..236 | CDD:293786 | 2/14 (14%) | ||
| ANK 6 | 201..234 | 2/14 (14%) | |||
| 2-5A binding (P-loop) 1 | 229..242 | ||||
| ANK 7 | 238..268 | ||||
| Ank_2 | 243..326 | CDD:289560 | |||
| 2-5A binding (P-loop) 2 | 253..275 | ||||
| ANK repeat | 272..326 | CDD:293786 | |||
| ANK 8 | 272..301 | ||||
| ANK 9 | 303..329 | ||||
| PKc_like | 375..587 | CDD:304357 | |||
| Pkinase | 387..586 | CDD:278497 | |||
| RNase_RNase-L | 590..708 | CDD:199218 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 715..741 | ||||
| bard1 | XP_017952998.2 | RING-HC_BARD1 | 41..84 | CDD:319410 | |
| PHA02876 | <324..>532 | CDD:165207 | 38/110 (35%) | ||
| ANK repeat | 429..459 | CDD:293786 | 10/30 (33%) | ||
| Ank_2 | 433..525 | CDD:403870 | 34/92 (37%) | ||
| ANK repeat | 461..492 | CDD:293786 | 15/30 (50%) | ||
| ANK repeat | 494..525 | CDD:293786 | 9/30 (30%) | ||
| BRCT_Bard1_rpt1 | 572..648 | CDD:349366 | 8/50 (16%) | ||
| BRCT_Bard1_rpt2 | 673..773 | CDD:349352 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| NCBI | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||